KEGG   Sorangium cellulosum So0157-2: SCE1572_19755Help
Entry
SCE1572_19755     CDS       T02718                                 

Definition
(GenBank) hypothetical protein
Organism
scu  Sorangium cellulosum So0157-2
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding Condensation PP-binding AMP-binding_C
Motif
Other DBs
NCBI-ProteinID: AGP36533
UniProt: S4Y0V8
LinkDB All DBs
Position
5601323..5606650
Genome map
AA seq 1775 aa AA seqDB search
MDSGAAFETLVELGRGRAARLGDELAYSFLVDGESERLDVTFAEIDRRARAVGAALQAIA
AAGERAVLLYAPGLDYVAAFLGCLYAGVVAVPAYPPDPARLGRTLPRLEAIAADAGARVV
LTTEAIAAMGDALAEQAPALRAGRWVSTDALAPGVEEAWRPPAISRGTLALLQYTSGSTG
APKGVMLTHGNLLANLGAIARGFRTGRASRGVIWLPPFHDMGLIGGVLEPLYAAFPVALM
SPLAFLERPMRWLRAVARFGATVSGGPNFAYDLCARKATAADVAALDLSTWDVAFTGAEP
VRHETLERFAATFAPCGFRREAFYPCYGLAEGTLIVTGGERGAGPALVTVDREALAGGRA
APPAPGRAAQTLVACGRAVDAGGEVRIVDPASTRDREDGEVGEIWVRGPSVSRGYWGRAE
ATAEAFGARREGAPDEGPYLRTGDLGYLRDGALFVTGRLKDLILVRGRNLYPDDLERTAE
ASHPALRRGCCAAFGVEAEGEERLVLVQEVDPRGAPDLAEVVAAVRREVQLQHDVAAHAV
VLIARGTIPKTSSGKIQRGACRAAFLAGDLEELARGSLDAGAPEGHAIEAPSTDLEREVA
AIWREVLGAPRLGATDGFFELGGDSLAAMQVIGRLRARLGLRVELSALFEAPTVRALSRR
LEAAARPAMALGALGGGEGAEGPGPIPRAPDAADHPLSYEQERLWILDQLLPGLTAYNLA
PAARLRGPLDREALARALEGLISRHAALRATFAASPDPVQRIGERRDVPVRFVDVSDQPE
GERERAARLAARAELTTPFDLAAGPLLRARLVRLGPEEHVLVLGVHHIAIDGWSFAPLLR
DLGALYESCRRGGAPALPPLAAQYVDFARWQRQALSGARLEGLVAWWARRLCDLPTVELP
TDRPRGAVQTFAGAERTAALPRRLLGELDALCQRAEVTRFMAWLAVLAVALRRATGQDDL
AIGTAVANRPRPELEGLVGMFVNTLVLRVDLAGDPSFAELLRRARATALEAFEHQDAPFE
KVVEALQPRRDMSRSPLFQVMLVVQSAPMPAMALGGLEVELLDLGVETTRFDLRFSVEAR
GGEEVVSLQYNTDLFDPQTADELLESLVQIAERAVRAPEARVAALLLTPEERRRALVTWN
ATEAPYEDHLCLHEPFFARASEQPEAVAVVAGGRRLTYAELRRRALAVSARVRRAGQGRG
QLVAIAMDKGWEQVAAALGVLHAGAAYLPIDPALPRERLAHLLAHGEARLALTQSHVDAR
IDWPAGVERALVDELDELGELDGDLRLPQRAAPAPGDLAYVIYTSGSTGQPKGVMIDHRG
AVNTILDVNRRFGVGRDDRVLALSSLSFDLSVYDLFGTLAAGGAIVLPPPGPGPQPDAWA
ALVRAERVTVWNSVPALLQLALDAAPAGASTMAPPDLASLRLVLLSGDWIDLKLPERIRA
ASPSARIVSLGGATEASIWSILHPIDRVDPRWRSVPYGRPMANQRVYVLDQALEPCPIGV
PGELYIGGVGVALGYFRDEARTAASFVTHPATGERLYRTGDLARYFRDGAVELLGRVDFQ
VKVRGYRVELGEIEAALLRHPDVKEAAVAVKQDPSGDRRLVAYVIGAGGLDPQGILASAR
RALPEYMVPSACVPVDAFPLSANGKVDRAALAAIDPRGGHGEAPRIPPRTPTERAIVGAL
KEVLQVEQIGVNENLFEIGLTSLLAVRAQRLLKERLRAPVAVADLFQSPTIEALAARVDA
SDPARGSTDAAEQRADARRDAARRRQAARGDRSNG
NT seq 5328 nt NT seq  +upstreamnt  +downstreamnt
atggactccggtgctgcattcgagacgctcgtcgagctcggccgtggccgcgcggcccga
ctcggtgacgagctcgcgtacagcttccttgtagacggcgagtccgagcggctcgatgtc
acgttcgcggagatcgatcgacgggcgcgcgccgtcggcgccgcgctccaggcgatcgcg
gccgcgggcgagcgcgcggtgctcctgtacgcgcccgggctcgactacgtcgccgcgttc
ctcggctgtctctacgccggcgtggtggccgtgccggcgtacccgccggatccggcgcgc
ctcggccggacgctgccccgcctcgaggcgatcgccgccgacgcgggcgcccgcgtcgtg
ctcaccaccgaggcgatcgcggcgatgggcgacgcgctggccgagcaggccccggcgctg
cgcgcggggcggtgggtcagcaccgacgcgctcgcgcccggcgtcgaggaggcctggcgt
ccgcccgcgatctcgcgcgggacgctcgcgctcctccagtacacctcgggctcgaccggg
gcgcccaagggggtgatgctcacgcacggcaacctgctcgcgaacctcggcgcgatcgcg
cgcgggttccggaccggccgcgcgtcgcgcggggtgatctggctgccgccgttccacgac
atggggctgatcggcggcgtgctcgagccgctctacgcggcgttcccggtcgcgctgatg
tccccgctcgcgttcctcgagcgcccgatgcggtggctgcgcgccgtcgcgcgcttcggc
gccacggtgagcggcgggccgaacttcgcgtacgacctctgcgcgcgcaaggcgaccgcg
gccgacgtggccgcgctggacctctcgacctgggacgtggcgttcacgggcgcggagccg
gtgcggcacgagacgctggagcgcttcgccgcgacgttcgcgccgtgcgggttccggcgc
gaggccttctacccctgctacgggctggccgaggggacgctgatcgtgacgggcggcgag
cgcggcgccgggcccgcgctggtcacggtcgatcgcgaggcgctcgccggcgggcgcgcg
gcgccgcctgcgccggggcgcgcggcgcagacgctcgtcgcgtgcggccgcgccgtcgac
gccggcggcgaggtgcggatcgtcgatccggcctcgacgcgggatcgagaggacggcgag
gtcggcgagatctgggtgcgcgggccgagcgtgtcgcgcggctactgggggcgcgccgag
gcgaccgccgaggcgttcggcgcgcggcgcgaaggcgcgccggacgaggggccgtacctg
cgcacgggcgacctcggctacctgcgcgacggggcgctcttcgtgacggggcggctcaag
gacctgatcctcgtccgcggccggaacctgtaccccgacgacctcgagcgcacggccgag
gcgagccacccggcgctgcgccgcggctgctgcgccgccttcggcgtcgaggccgagggc
gaggagcggctcgtcctcgtccaggaggtcgacccgcgcggggcgcccgacctcgcggag
gtcgtcgcggcggtgcgccgcgaggtgcagctccagcacgacgtggcggcgcacgcggtg
gtgctgatcgcgcgggggacgatcccgaagacctcgagcggcaagatccagcgcggcgcc
tgccgcgcggcgttcctggccggcgacctcgaggagctcgcgcgcgggtcgctggacgcc
ggcgcgccggaggggcacgcgatcgaggcgccgtcgaccgacctggagcgggaggtcgcc
gcgatctggcgcgaggtgctcggggcgccgcggctgggggcgaccgacggcttcttcgag
ctgggcggcgactcgctcgccgcgatgcaggtgatcgggcgcctccgggcccggctcggg
ctccgcgtcgagctgagcgcgctcttcgaggcgccgacggtccgcgcgctgtcgcgccgg
ctcgaggccgccgcccggccggcgatggccctcggcgcgctcggcggtggcgagggcgcc
gagggcccggggccgatcccgcgcgcgcccgacgcggcggatcacccgctctcctacgag
caggagcgcctctggatcctcgaccagctcctccccgggctgacggcctacaacctggcc
ccggcggcgcggctccgcggcccgctcgaccgggaggccctcgcgcgggcgctcgagggg
ctgatcagccgccacgccgcgctccgcgccacgttcgcggcgagcccggacccggtgcag
cgcatcggcgagcgccgcgacgtcccggtgcgcttcgtggacgtgtccgaccagcccgag
ggcgagcgcgagcgcgcggcgcggctcgccgcccgcgcggagctcacgacgccgttcgac
ctcgccgcgggcccgctgctccgggcccgcctcgtgcggctcgggccggaggagcacgtc
ctcgtgctcggcgtgcaccacatcgcgatcgacgggtggtcgttcgcgcccctcctccgg
gacctgggcgccttgtacgagagctgtcgtcgcgggggcgctccggcgctcccgccgctc
gcggcgcagtacgtcgacttcgcccgctggcagcggcaggcgctctcgggcgcgcgcctc
gaggggctcgtcgcgtggtgggcgcggcgcctctgcgacctgccgacggtcgagctgccg
acggatcggccgcgcggcgccgtccagacgttcgccggcgccgagcggacggcggcgctc
ccccggcgcctgctcggcgagctcgacgcgctctgccagcgcgcggaggtcacgcggttc
atggcgtggctcgccgtgctcgccgtggcgctccggcgcgccaccggccaggacgatctc
gcgatcggcaccgcggtcgcgaaccgcccgcgccccgagctcgaggggctcgtcggcatg
ttcgtgaacacgctcgtcctgcgcgtggacctcgccggcgacccgagcttcgccgagctg
ctccggcgcgcccgggcgacggcgctcgaggcgttcgagcaccaggacgcgccgttcgag
aaggtcgtcgaggcgctgcagccgaggcgtgacatgagccggtcgccgctcttccaggtg
atgctcgtcgtccagagcgcgccgatgcccgcgatggcgctcggcggcctcgaggtcgag
ctcctcgacctcggggtggagacgacgcgcttcgacctgcgcttctccgtggaggcgcgc
ggcggcgaggaggtcgtctcgctgcagtacaacaccgacctcttcgacccgcagacggcc
gacgagctcctcgagtcgctcgtgcagatcgcggagcgggcggtccgcgcgccggaggcg
agggtcgcggcgctcctgctcacgcccgaggagcgccggcgcgcgctcgtgacgtggaac
gcgaccgaggcgccgtacgaggaccacctctgcctgcacgagccgttcttcgcgcgggcg
agcgagcagccggaggcggtcgcggtcgtcgctggcggccggcggctgacgtacgcggag
ctgcgccggcgcgcgctcgccgtctcggcgcgcgtccggagggccgggcaggggcgcggc
cagctcgtggcgatcgcgatggacaagggctgggagcaggtcgccgccgcgctcggcgtg
ctgcacgccggggcggcgtacctgccgatcgatcccgcgctgccgcgcgagcggctcgcc
cacctgctcgcgcacggcgaggcgcgcctcgcgctcacgcagtcgcacgtcgacgcgcgg
atcgactggcccgccggggtcgagcgcgcgctcgtggacgagctggacgagctgggcgag
ctcgacggcgatctgcgcctccctcagcgcgccgcgcccgcgccgggcgacctcgcgtac
gtcatctacacctccggatccaccggccagccgaagggggtgatgatcgaccaccgcggc
gcggtgaacacgatcctcgacgtgaaccgccggttcggcgtcgggcgcgacgaccgcgtg
ctcgcgctctcgtccctgagcttcgatctgtcggtctacgacctcttcggcacgctcgcg
gcgggcggcgccatcgtcctgccaccgccgggccccgggccgcagcccgacgcgtgggcc
gcgctggtgcgggccgagcgcgtgaccgtctggaactcggtgcccgcgctgctccagctc
gcgctggacgccgcccccgccggcgccagcacgatggcgccgcccgatctcgcgtcgctc
cgcctggtgttgctgagcggcgactggatcgacctgaagctccccgagcggatccgggcc
gcgtccccgtccgcgcggatcgtcagcctgggcggcgccaccgaggcgtcgatctggtcg
atcctgcacccgatcgaccgcgtcgatccgcgctggcgcagcgtcccgtacggccgcccc
atggcgaaccagcgcgtctacgtcctcgaccaggcgctcgagccgtgtccgatcggcgtc
ccgggcgagctctacatcggcggcgtcggcgtcgcgctcggctacttccgcgacgaggcc
cggaccgccgcgagcttcgtcacgcacccggcgaccggggagcggctctaccgcaccggc
gatctcgcccggtacttccgcgacggcgccgtcgagctgctcgggcgggtcgacttccag
gtgaaggtgcggggctaccgcgtcgagctcggcgagatcgaggcggcgctgctccggcac
ccggacgtgaaggaggccgcggtcgccgtcaagcaggacccctcgggcgaccggcgcctc
gtcgcgtacgtcatcggcgccggcggcctggatccgcaggggatcctcgcgtccgcgcgg
cgggcgctccccgagtacatggtcccgagcgcgtgcgtcccggtggacgccttcccgctg
agcgcgaacggcaaggtcgaccgcgcggcgctcgccgcgatcgacccgcgcggcggccat
ggcgaggcgccgcggatcccgccgcgcacgccgaccgagcgcgcgatcgtcggggcgctc
aaggaggtgctccaggtcgagcagatcggcgtcaacgagaacctcttcgagatcgggctg
acgtcgctgctcgcggtgcgcgcgcagcggctgctcaaggagcggctgcgcgccccggtc
gcggtggcggacctgttccagtcgccgacgatcgaggcgctcgccgcgcgcgtcgacgcg
agcgatccggcgcgcgggtccacggacgcggccgagcagcgcgcggacgcgcgccgggac
gcggcgcgccgccggcaggccgcgcgcggggatcggtcgaacggatga

DBGET integrated database retrieval system