KEGG   Sorangium cellulosum So0157-2: SCE1572_23880Help
Entry
SCE1572_23880     CDS       T02718                                 

Definition
(GenBank) peptidyl-dipeptidase A
  KO
K01283  peptidyl-dipeptidase A [EC:3.4.15.1]
Organism
scu  Sorangium cellulosum So0157-2
Brite
KEGG Orthology (KO) [BR:scu00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:scu01002]
    SCE1572_23880
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:scu04147]
    SCE1572_23880
   04090 CD molecules [BR:scu04090]
    SCE1572_23880
Enzymes [BR:scu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.15  Peptidyl-dipeptidases
    3.4.15.1  peptidyl-dipeptidase A
     SCE1572_23880
Peptidases [BR:scu01002]
 Metallo Peptidases
  Family M2
   SCE1572_23880
Exosome [BR:scu04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   SCE1572_23880
CD molecules [BR:scu04090]
 Proteins
  SCE1572_23880
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M2
Motif
Other DBs
NCBI-ProteinID: AGP32495
UniProt: S4XL58
LinkDB All DBs
Position
complement(6719591..6721426)
Genome map
AA seq 611 aa AA seqDB search
MVRMVPVLVVALPCGALALTAACSDPSPPPRPRPGSQPAAEEAQRFIEQAESELHELSTQ
NNRAAWVASTYITVDTQVLAAAASAKLLGAQTDYAERAARYRDLDLPYDVRRRLDLLRTS
LTLYAPADPAKTQELATIASRLEATYGAGKYCPSAGQCLDLQELSRIIAKSRDPEELKRA
WVGWRTVSAPMRGDFTRLTALANEGARELGFKDTGDAWRAKYEMPLEALPREVDRLFGQV
KPLYDALHCYVRGRLAARYGEDVVPGARPIRADLLGDMWAQDWSNIHDLVAPEGVAPIYD
LDAALRAKGFTPIEMVKTGERFFVSLGFEPLPATFWERSLFVKPADRDVVCHASAWNIDD
EEDLRIKMCIDITADDFQTIHHELGHTFYQRAYNHLPWLYRDSPNPAFHEALGDTIGLSV
TPAYLQRIGLVDELPPPSSDVSLLLRDALAKVAFLPFAVLVDRWRWGVFSGDIPPAEYNK
AWWDLRRRYQGVTPPVPRSEADFDPGAKYHVAASVPYIRYFFAHILQFQLHRALCEEAGH
KGPLHRCTIYGSEQAGERLRRMMEMGRSRPWPEALEAVTGSRRMDAAAMLAYFAPLRGWL
DRQNRGRKCGW
NT seq 1836 nt NT seq  +upstreamnt  +downstreamnt
atggtgcgcatggttccggtgttggtcgtcgccttgccgtgcggcgcgctcgcgctcacg
gcggcctgctccgatcccagccctccgccgcggccgcggcccggctcacagcctgcggcg
gaggaggcccagagattcatcgaacaagcggaatcggagctccacgagctcagcacccag
aacaaccgggccgcctgggtcgcgtcgacgtacatcacggtcgatacgcaggtcctcgcg
gccgcggcgagcgcgaagctgctcggcgcgcagaccgactacgccgagcgcgcggcccgc
taccgcgacctcgacctgccctacgacgtccgccggcggctcgatctcctgcgcacctcg
ctcaccctctacgcgcccgccgacccggcgaagacgcaggagctcgcgacgatcgcgtcg
aggctggaggccacgtacggcgcgggcaaatactgcccctcggccggccagtgcctcgat
ctccaggagctcagcaggatcatcgcgaagagccgcgatcccgaggagctcaagcgagcg
tgggtcggctggcgcacggtctccgcgccgatgcgcggcgacttcacgcggctcacggcg
ctggcgaacgagggcgcccgcgagctcgggttcaaggacaccggcgacgcctggcgcgcg
aaatacgagatgccgctagaggcgctgccccgggaggtcgaccgcctcttcgggcaggtc
aagccgctctacgacgccctccactgctacgtgcgcggccgcctcgccgcgcgctacggc
gaggacgtcgtgcccggcgcgcgcccgatccgggccgatctgctcggcgacatgtgggcc
caggactggagcaacatccacgatctcgtcgcgcccgagggggtcgcgccgatctacgat
ctcgacgccgcgctccgcgcgaaggggttcacgccgatcgagatggtgaagacgggcgag
cgcttcttcgtctcgctcgggttcgagccgctcccggccaccttctgggagcgatcgctc
ttcgtcaagccggcggatcgcgacgtcgtctgccacgcgagcgcgtggaacatcgacgac
gaggaggatctgcgcatcaagatgtgcatcgacatcacggcggacgacttccagacgatc
caccacgagctcggccacaccttctatcagagggcgtataaccacctcccgtggctgtac
cgcgacagcccgaacccggcgttccacgaggccctcggcgacaccatcgggctgtcggtc
acgccggcgtacctccagcggatcgggctcgtggacgagctgcccccgccgtcgagcgat
gtctcgctcctcctccgcgacgccctcgccaaggtggccttcctgccgttcgcggtcctc
gtcgatcggtggcgctggggggtcttctccggggacatcccgccggcggagtacaacaag
gcctggtgggatctccggaggagataccagggcgtgacgccgccggtgccccgctccgag
gcggacttcgaccccggcgcgaaataccatgtggcggcgagcgtcccgtacatccggtat
ttcttcgcgcatatcctccagttccagctccaccgcgcgctctgcgaggaggcggggcac
aaggggccgctccaccgctgcacgatctacggcagcgagcaggccggcgagcggctccgg
cggatgatggagatggggcggagcaggccgtggccggaggcgctcgaagcggtgaccgga
tcgcggcggatggatgcggcggcgatgctcgcctacttcgcgccgctcaggggctggctc
gatcggcagaaccgcggcaggaagtgcggatggtag

DBGET integrated database retrieval system