KEGG   Sorangium cellulosum So0157-2: SCE1572_24090Help
Entry
SCE1572_24090     CDS       T02718                                 

Definition
(GenBank) hypothetical protein
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
scu  Sorangium cellulosum So0157-2
Pathway
scu00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:scu00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    SCE1572_24090
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:scu02000]
    SCE1572_24090
Enzymes [BR:scu01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     SCE1572_24090
Transporters [BR:scu02000]
 Other Transporters
  Pores ion channels [TC:1]
   SCE1572_24090
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N GST_C GST_C_3 GST_N_3 GST_C_2 GST_N_2 2Fe-2S_Ferredox
Motif
Other DBs
NCBI-ProteinID: AGP37291
UniProt: S4XY55
LinkDB All DBs
Position
6777243..6777848
Genome map
AA seq 201 aa AA seqDB search
MKLYFSPGTCSLSPHIALREAGLEFDLERVHLGTKKTRSGADFTLINPKGYVPALEIEGG
EVLTEGPAIVQYIADRRPESGLAPPAGTLGRYRLQEWLNFIGTELHKQFAPLFKPRAPDE
QKSAARATLGQRFGYVAQRLDGATYLLGEQFTVADGYLFTVLTWTRFAGVDLGGWPVLGQ
YKDRVGARPAVQAAIAAEKGK
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atgaagctctatttcagccccggcacgtgttcgctgtctccccacatcgcgctgcgcgag
gctggcctggagttcgacctcgagcgcgtccacctcggcacgaagaagacgagatccggc
gccgacttcaccctgatcaaccccaagggctacgtccccgcgctcgagatcgagggcggc
gaggtgctcaccgaggggccggcgatcgtccagtacatcgccgatcgaaggcccgagtcc
gggctcgcgccgcctgcgggcaccctcggtcgctaccggctccaggagtggctcaacttc
atcggcaccgagctgcacaagcagttcgcgcccctcttcaagccgcgggcgcccgacgag
cagaagagcgcggcgcgggcaaccttgggccagcgcttcgggtacgtggcgcagcggctc
gacggcgccacgtacctcctcggcgagcagttcacggtggcggacggctacctcttcacc
gtgctcacctggacgcggttcgcgggcgtcgatctcggcggctggcccgtcctcggccag
tacaaggaccgcgtcggcgcccgccccgccgtgcaggccgccatcgcggccgagaagggc
aagtag

DBGET integrated database retrieval system