KEGG   Sorangium cellulosum So0157-2: SCE1572_24265Help
Entry
SCE1572_24265     CDS       T02718                                 

Definition
(GenBank) amylase
  KO
K01178  glucoamylase [EC:3.2.1.3]
Organism
scu  Sorangium cellulosum So0157-2
Pathway
scu00500  Starch and sucrose metabolism
scu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:scu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    SCE1572_24265
Enzymes [BR:scu01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.3  glucan 1,4-alpha-glucosidase
     SCE1572_24265
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glucodextran_N Glyco_hydro_15 CBM_20
Motif
Other DBs
NCBI-ProteinID: AGP37324
UniProt: S4XXV0
LinkDB All DBs
Position
complement(6828290..6830866)
Genome map
AA seq 858 aa AA seqDB search
MRAAAAGLSAAGAGAASVWGPAEKSFLGTSTTSASRVYFTGYRGIVSEVFYPVLDTVNTV
DLQFMVGDTAKTFVDEEKQQSYTVTQPDKRSMRWQAVTSNSAHNWRITKSIFTDPGRNAL
IQRVQFDALNGRNVTQFNLYLLHNPAMDNSGGGDTSKTVTAGGRAMLVASENSRFSALAT
SQPWKTQTSGGLPMVSSGFVGATDGWTDLLGGTSDKTMSWRNDLASGGNVAQMGWVDLGA
SAVTSVSFDVVLAFGATEAEATTTANATLGSNLTTLRTTYDSGWNGYASGLDNQGGTADD
QYYLAAMSLKTIQDKSNGAMIAGMGTPWGETNGDANNGGYHLVWPRDLFKFASALVTAGD
TATATSVVNYLFNTLQQSSDCGISEYNAPPSCLQGYSRVGRFPQNAWVSGWQYWQGTQMD
EQAMPIILAWRLGPSVYNPLWPKIKLTADYIVNTGPWTQQERWEENSGYSPSTIAAEIAG
LVCAATIARANNDTTSAARYLAAADYWQQSVDRWTFTTTGFHEVNGQHSYHVRINPADPN
ITGTGRQRYNPVSGPDAATPLTIGNGGGTHDHRYIVDGGFLELVRMGVKRPDDASIVATM
KIYDKILKRTIAGKGDAWFRYNYDAYGEENGGGNFDGNGGRGRLWPIFTAERGMYEIALS
GLGSQGSTYLAAVKAFSTPQGFIPEQVWSETTNVTGWIVEKPSNATAGTPTRSMSPLNWA
MGEYISLLASIRAGKVVDIPSVVCSRYNACVVPPASGQASVVFNATASTVVGQHVYVTGN
TAALGNWNTALAIPVDPRSYPVWTNRVNLPAGSALLYKYFRTNVDGSVTWENLPGGGNRT
LNTPASGGTLTRNDTVTW
NT seq 2577 nt NT seq  +upstreamnt  +downstreamnt
gtgagagccgccgccgccggcctcagcgcggcgggcgcgggggcagcctcggtgtggggg
cctgccgagaagtcgttcctcggcacgtcgacgacctcggcctcgcgggtctacttcacc
gggtaccggggcatcgtgtccgaggtgttctatccggtgctcgacacggtcaacaccgtc
gacctgcagttcatggtgggggatacggcgaagaccttcgtcgacgaggagaagcagcag
agctacaccgtcacccagccggacaagcgctccatgcggtggcaggcggtcaccagcaac
agcgcccacaactggcggatcaccaagagcatcttcaccgatccggggcgcaacgcgctg
atccagcgcgtccagttcgacgcgctgaacggcaggaacgtcacccagttcaacctctac
ctgctccacaacccggccatggacaactccgggggcggcgacacgtcgaagaccgtgacg
gcgggcgggcgcgcgatgctcgtcgcctcggagaacagccgcttctcggcgctcgccacc
tcgcagccgtggaagacgcagacgagcggcggcctgccgatggtgtcgagcggcttcgtc
ggcgcgaccgacggctggaccgacctgctcggcggcacctccgacaagacgatgagctgg
cgcaacgacctcgcgagcggcggtaacgtggcgcagatgggctgggtcgatctcggcgcg
agcgcggtcaccagcgtctcgttcgacgtggtgctcgccttcggcgccaccgaggcggag
gcgacgaccaccgcgaacgcgacgctcggcagcaacctgaccaccctgcggaccacctac
gacagcgggtggaacggctacgcgagcgggctcgacaaccagggcggcaccgccgacgac
cagtattacctcgcggcgatgtcgctgaagacgatccaggacaagtcgaacggcgccatg
atcgccgggatgggcacgccgtggggcgagaccaacggcgacgccaacaacggcggctat
cacctggtgtggccgcgcgatctgttcaagttcgcgagcgcgctcgtgacggccggggac
acggcgaccgcgacctcggtcgtcaattacctgttcaacacgctccagcagtcgagcgac
tgcggcatctcggagtacaacgcgcccccgagctgcctgcagggctacagccgcgtcggc
cgctttccgcagaacgcctgggtcagcgggtggcagtactggcagggcacgcagatggat
gagcaggcgatgccgatcatcctcgcctggcgcctcggcccgtcggtgtacaacccgctg
tggccgaagatcaagctgacggccgactacatcgtcaataccggcccctggacgcagcag
gagcgctgggaggagaactccgggtactcgccgtcgaccatcgccgcggagatcgccggc
ctcgtctgcgcggccacgatcgcgcgcgcgaacaacgacaccacgagcgccgcccgctac
ctggcagccgccgactactggcagcagagcgtcgaccgctggacgttcacgaccaccggc
tttcacgaggtgaacggccagcacagctatcatgtccgcatcaacccggcggacccgaac
atcaccggcacagggcggcagcgttataaccccgtgtccgggccggacgcggcgaccccc
ctcacgatcggcaacggcggcggcacgcacgaccatcgctacatcgtcgacggcgggttc
ctcgagctcgtgaggatgggggtgaagcgcccggacgacgcgtcgatcgtcgcgacgatg
aagatctacgacaagatcctgaagcggaccatcgccggcaagggcgacgcctggttccgc
tacaactacgacgcgtacggcgaggagaacggcggcggcaacttcgacggcaacggcggc
cggggccggctgtggcccatcttcacggccgagcgcggcatgtacgagatcgccctctcg
ggcctcggcagccaaggcagcacctacctcgccgcggtcaaggcgttctcgacgccgcag
ggcttcatcccggagcaggtgtggagcgagacgacgaacgtcaccggctggatcgtcgag
aagccgtcgaacgctaccgcgggcaccccgacgaggtcgatgagcccgctgaactgggcc
atgggcgagtacataagcctgctggcgtcgatccgcgcgggcaaggtcgtcgacatcccg
tcggtggtctgcagccgctacaacgcgtgtgtcgtgccgcccgcgtcaggccaggcgagc
gtcgtgttcaatgcgaccgcgagcaccgtggtcggtcagcacgtgtacgtcaccgggaac
accgcggcgctgggcaactggaataccgctctcgccatcccggtcgatccgcgcagctac
ccggtgtggacgaaccgcgtcaacctgccggccggcagcgccctgctgtacaagtacttc
cgcacgaacgtcgatggctccgtgacctgggagaacctgcccggtgggggcaatcgcacg
ctgaacaccccggcgtccggcgggacgctcacgcgtaacgacaccgtgacctggtaa

DBGET integrated database retrieval system