KEGG   Sorangium cellulosum So0157-2: SCE1572_29505Help
Entry
SCE1572_29505     CDS       T02718                                 

Definition
(GenBank) hypothetical protein
  KO
K01286  D-alanyl-D-alanine carboxypeptidase [EC:3.4.16.4]
Organism
scu  Sorangium cellulosum So0157-2
Brite
KEGG Orthology (KO) [BR:scu00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    SCE1572_29505
Enzymes [BR:scu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     SCE1572_29505
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Beta-lactamase
Motif
Other DBs
NCBI-ProteinID: AGP38254
UniProt: S4Y0F8
LinkDB All DBs
Position
8385862..8386884
Genome map
AA seq 340 aa AA seqDB search
MGCDALAVELQAALDAAIGAQRLPGAAAAVDVGGCSFRGAAGMADVATGTPMDPGDLFRA
GSITKTFISTLVLMLRADGDLSLEDDVSSYVPGVPGGDRITIRQILNHTSGLFNYTETHG
FLSAVEADPTRVWAPEELIAFSAREPPCFEPGRGFEYSNTNYIVAGLIVEAVSGKPTVEL
LRTRILEPAGLANTYLDGAEPAVPGLVRGYGSYDGELVDTTSAVDPSSAWTSGGLVSNTD
DLTTFFVRLLDGGLLGPAELADMTAGVGAEEADLLEYGLGLAQRSSPVGITHGHGGSMWG
FVSASFYAVERGAAITVLVNHEDGDAEKIVDDLSRILTVP
NT seq 1023 nt NT seq  +upstreamnt  +downstreamnt
gtgggctgcgatgcgctcgccgtcgagctccaggccgctctcgacgcggcgatcggcgcg
cagaggctccccggcgccgccgcggccgtggacgtcggaggatgctcctttcgcggagcg
gcgggaatggcggacgtcgcgacggggacgccgatggatccaggggatctctttcgcgcc
gggagcatcaccaagacgttcatctcgacgctggtcttgatgctccgcgccgacggcgac
ctatcgctcgaggatgacgtatcgagctacgtgccgggtgtccccggcggcgaccggatc
acgatacgtcagatcctgaaccacaccagcggtctgttcaattacacggaaacccacggc
ttcctgagcgccgtcgaggccgacccgacccgcgtgtgggcccccgaggagctcatcgcc
ttctcggccagagagccgccgtgcttcgagccggggcggggtttcgagtactccaacacg
aactacatcgtcgctggcctcatcgtcgaggcggtgtccgggaagcccaccgtcgagctg
ctgcgcacccgcatcctcgagcccgcgggcctcgccaacacctacctcgacggcgcggag
cccgccgtgcctgggctcgtgcgcggctacgggtcgtatgacggcgagctcgtcgatacg
acgtccgccgtggatccgtcgtccgcgtggacgtccggtggcctggtgtcgaacacggat
gacctcaccacgttcttcgtccggctcctcgacggcgggctgctcggcccagccgagctc
gcggacatgaccgccggggtcggcgccgaggaggccgacctgctggaatacggcctcggg
ctggcccagcgctcctcgccggtcggtatcacccacggacatggcggcagcatgtggggc
ttcgtgtccgcgtcgttttacgcggtcgagcgcggtgccgccatcaccgtgctggtcaac
cacgaagacggcgacgcagagaagatcgtcgacgatctatcgcgcatcctgacggtgccc
tga

DBGET integrated database retrieval system