KEGG   Sorangium cellulosum So0157-2: SCE1572_42745Help
Entry
SCE1572_42745     CDS       T02718                                 

Definition
(GenBank) dolichyl-phosphate beta-D-mannosyltransferase
  KO
K00721  dolichol-phosphate mannosyltransferase [EC:2.4.1.83]
Organism
scu  Sorangium cellulosum So0157-2
Pathway
scu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:scu00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:scu01003]
    SCE1572_42745
Enzymes [BR:scu01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.83  dolichyl-phosphate beta-D-mannosyltransferase
     SCE1572_42745
Glycosyltransferases [BR:scu01003]
 N-Glycan biosynthesis
  Dol-P-Man biosyntheisis
   SCE1572_42745
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glycos_transf_2 Glyco_tranf_2_3 Glyco_tranf_2_4
Motif
Other DBs
NCBI-ProteinID: AGP32843
UniProt: S4XQF3
LinkDB All DBs
Position
12028103..12028825
Genome map
AA seq 240 aa AA seqDB search
MAPRILVITPTYNERDNLAEFVGSVLAAVPDAHVLVVDDASPDGTGALGDALAARDGRVR
VLHRPAKLGLGTAYLEGFQRALDGGYDVAFEMDADLSHDPGHLPAFLGAIAEGADVVLGS
RNMPGGGVEGWGLGRHVLSKGGSLYARTILGVGVRDMTTGYKAFTRRALLALDLGSVRSN
GYAFQIETTYRALRKGLRVVEVPIVFVDRRAGHSKMSRRIFAEAIVEVFRLKLDAARGRI
NT seq 723 nt NT seq  +upstreamnt  +downstreamnt
atggccccccgaatcctcgtcatcacgccgacgtacaacgagcgagacaacctcgccgag
ttcgtgggctccgtcctcgcggcggtcccggacgcgcacgtgctcgtcgtcgacgacgcg
tcgccggacgggacgggcgccctcggcgacgcgctcgccgcgcgcgacgggcgcgtccgc
gtgctccaccgaccggccaagctcgggctcggcacggcctacctggaggggttccagcgc
gcgctcgacggcggctacgacgtcgcgttcgagatggacgcggacctctcgcacgacccg
ggccacctgcccgccttcctcggcgcgatcgccgagggcgccgacgtggtcctcggctcg
cgcaacatgccggggggcggcgtcgagggctggggcctcgggcggcacgtgctctcgaag
ggcggctcgctctacgcgcgcaccatcctgggcgtcggcgtccgcgacatgacgaccggc
tacaaggccttcacgcggcgcgcgctcctcgcgctcgatctcggcagcgtgcgctcgaac
ggctacgccttccagatcgagacgacctaccgggcgctccgcaaagggctccgcgtcgtc
gaggtgccgatcgtgttcgtcgaccgccgcgccggccactcgaagatgagccggaggatc
ttcgccgaggcgatcgtcgaggtcttccgcctgaagctcgacgccgcgcgcgggcgcatc
tga

DBGET integrated database retrieval system