KEGG   Sorangium cellulosum So0157-2: SCE1572_48230Help
Entry
SCE1572_48230     CDS       T02718                                 

Definition
(GenBank) hypothetical protein
Organism
scu  Sorangium cellulosum So0157-2
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding Condensation PP-binding AMP-binding_C baeRF_family2
Motif
Other DBs
NCBI-ProteinID: AGP41609
UniProt: S4Y9M3
LinkDB All DBs
Position
complement(13549976..13555432)
Genome map
AA seq 1818 aa AA seqDB search
MESNRSQTGAISDRDAAEPATLVALLRRRAEQRPSAHAYTFLLDGETDARSMTYGELDQR
ARALAAELQPGARAGERALLLVPPGLDFIAAFFACLYAGLVAGAGPVPQRKSGLLRVLAI
VRDCRPSVVLTTEAFLGAAAMPVPLPQRKSGLLRVLAIVRDCRPSVVLTTEAFLGAAAML
REDPSLAELSQLRCVAVDAARDGQGDGWRPPRVTAETVAFLQYTSGSTGTPKGVVLTHEN
LLRNERMIQRAFAHTEESVIVGWLPPHHDMGLIGNILQPLYVGVPCVQLSPDQFLMRPRR
WLEAISRYRATTSGGPNFAYELCVRKIAPEQRGGLDLASWKVAFNGAEPVRAATLDRFAE
AFAPAGFRRAAFYPCYGLAEATLLVSGGAADAPPVVRAADRAALEQGRAAFDPRDPEAAV
ALVGCGRSPDGDEVRIVDPETRRPCEDERVGEIWVAGASVAQGYWERPEDTAATFEARLA
TGGGPFLRTGDLGFLSRGELYVTGRLKDLIIVRGRNVYPQDLELTAEQSHPGLRAGGGAA
FSVDVDGEERVVLVQELGRGAAASADPAEIGAAIQRAVADRHEVAIHAVALIKPGSLPRT
TSGKVQRRACRARFLDGSLGTVWRSALEPPAGAGDEREEPPRTALERALAGIWAEVLGRA
RIGRDEEFLSLGGDSLRAMQVSGRVSEALGVEVGPAQLFETTTVAALAAWIEGRQGSAPA
GGAAPLAPEERPERPPLSLVQERLWFLEQLVAGAPVYHIAAALRLSGALDTGALEQAVTA
LAARHEALRTSFPSACGQPFQRIAPAAKVALPIEDLGALAEEDREPALRARLREEARRAF
DLAEAPPVRWTLLRKGEREHALAITCHHLIADGWSMNVLLRELALIYGALAAGRAPELAP
LPIQPADHALWQRRTEQAAARERELAYFRERLKGPVPPLSLPTDRPRPSVQSYAGAREEL
ALPPELVARLTALGRGAGATLFTTVAAGLFALLHRYTGQSDVCIGTPVAARPRAALEGAV
GCFLNTLALRVDLAGNPRVAELIARVRAAVTEGQAHQEAPFERVLEALSLERSLSHSPLF
NVMLAMDPAPERAPEIPGLSIEVQRVDTGTAQFDLALNLTLDGQGARGAWEYNTDLFDRA
TVARMARHLVAILEGFAAAPEARLSDLPMMDAGERRQVLAGWNATERAYPGDLRVHALFE
AQAARTPDATAVIFEDRRLSYRELDARANQVAHALRRRGVGPDGLVAVAAERSVELVVAL
LGVLKAGAAYVPIDPDYPAERIAFMLDDAAAPVLLTQWPVASRLPPHRAQLLCLDADRAA
LDGESTAKPAVAVSPDNLAYTIYTSGSTGRPKGAGNTHRGLLNRLQWMQERYALTAEDRV
FQKTPFSFDVSVWEFFWPLITGAGLVVARPGDHRDGERLIELIARHGVTTVHFVPPMLQA
FLETPGASSCASLRRVICSGEALPAELARRCFERLPHAELHNLYGPTEASIDVTAWACQP
LDTSASVPIGTPIANTQIYLLDRHGHPVPVGVAGELYIGGVGLARGYHNRPALTAERFVP
DPFGAAPGGRLYRTGDLARHRPDGAIEFLGRLDHQVKLRGLRVELGEIEARLLLHPSVGE
AVVLARDEAHGGKRLVAYVTGRDGATPEPETLRAWLADALPAYMVPAPILPLPRLPLSPN
GKVDRRALPAPEQVNAPTRATTPPRTDLERAIAAIWRDVLSTPQVGVHDNFFDLGGHSLL
LAKVHSRLREEVDRALPMLVLFQHPTIASLAAALSREASEPAPEEGERSGERASAAQERR
GELFARRRGGRGALETKK
NT seq 5457 nt NT seq  +upstreamnt  +downstreamnt
atggagtcgaaccgatcacagacgggtgcgatcagcgatcgcgacgcggccgagcccgcg
acgctggtcgcgctgctgcggcgtcgcgcggagcagcgcccgtccgcgcacgcctatacc
ttcctgctcgacggggagacggacgctcgctcgatgacgtacggcgagctggaccagcgg
gcgcgcgcgctcgccgcggagctccagcccggcgcgcgggcgggcgagcgcgcgctgctc
ctggtgccgccggggctcgacttcatcgcggcgttcttcgcctgcctctacgcggggctc
gtggcgggggcggggccggtgccgcagcgcaagagcgggctgctccgcgtgctggccatc
gtgcgcgactgccgcccgagcgtcgtcctcaccacggaggcgttcctcggcgccgcggcg
atgccggtgccgctgccgcagcgcaagagcgggctgctccgcgtgctggccatcgtgcgc
gactgccgcccgagcgtcgtcctcaccacggaggcgttcctcggcgccgcggcgatgctc
cgcgaggatccgagcctcgccgagctgagccagctgcgctgcgtggccgtcgacgcggcc
agggacggccagggagacgggtggcggccgccgcgcgtgaccgccgagaccgtggcgttc
ctccagtacacctcggggtcgaccgggacgcccaagggcgtcgtgctcacgcacgagaac
ctgctgcgcaacgagcgcatgatccagcgcgcgttcgcgcacaccgaggagagcgtgatc
gtcgggtggctgccgccgcaccacgacatggggctcatcggcaacatcctgcagccgctc
tacgtgggcgtgccgtgcgtccagctctcgcccgaccagttcctgatgcggccgcggcgc
tggctggaggcgatctcgcgctaccgggccacgacgagcggcgggccgaacttcgcctac
gagctgtgcgtccgcaagatcgccccggagcagcggggagggctcgatctcgcctcgtgg
aaggtggccttcaacggggccgagccggtgcgcgcggcgacgctcgatcgcttcgccgag
gcgttcgcgccggcgggcttccggcgcgcggcgttctacccctgctacgggctcgccgag
gcgacgctgctcgtcagcggcggcgcggcggacgcgccgccggtcgtgcgcgcggccgac
cgcgcggcgctggagcaagggcgcgcggcgttcgatccgcgcgacccagaggccgccgtc
gccctcgtgggctgcgggcgatcgccggacggcgacgaggtgcggatcgtcgatcccgag
acgcggaggccctgcgaggacgagcgcgtcggcgagatctgggtggccggcgcgagcgtg
gcccagggctactgggagcggccggaggacacggcggcgacgttcgaggcccggctggcc
acgggaggagggccgttcctccggaccggcgatctcgggttcctgtcgcgcggcgagctc
tacgtgaccggccggctcaaggacctgatcatcgtccgcgggcgcaacgtttacccgcaa
gatctcgagctcaccgcggagcagagccacccgggcctccgcgccggcgggggcgcggcg
ttctcggtggacgtggacggcgaggagcgcgtcgtcctggtccaggagctcggaaggggc
gccgccgcgtcggcggatccggcggagatcggcgcggcgatccagcgcgccgtggccgat
cggcacgaggtcgcgatccacgcggtggcgctgatcaagccggggagcctgccgcggacc
acgagcggcaaggtgcagcggagggcgtgccgcgcgcggttcctcgacggctcgctgggc
acggtctggcgatcggcgctcgagccgccggccggcgcgggcgacgagcgcgaagagccg
ccgcggacggcgctggagcgcgcgctggccgggatctgggcggaggtgctggggcgcgcg
cggatcgggcgggacgaggagttcctgagcctgggcggcgactcgctgcgggcgatgcag
gtgagcggccgggtgagcgaggccctcggcgtcgaggtggggccggcgcagctcttcgag
acgacgacggtcgcggcgctggcggcctggatcgagggcaggcagggcagcgcgcccgcg
ggcggcgccgcgccgctcgcgccggaggagcggccggagcggccgccgctgtccctcgtg
caagagcgcctgtggttcctggagcagctggtcgccggggcgcccgtctatcacatcgcg
gcggccctgcggctctccggagcgctcgatacaggcgcgctggagcaggcggtgaccgcg
ctcgcggcccgccacgaggcgctgcgcacgagctttccgtcggcgtgcgggcagcccttc
cagaggatcgcgccggccgcgaaggtcgcgctgccgatcgaggacctcggcgcgctcgcc
gaggaggaccgggagccagcgctgcgagcgcgcctccgggaggaggcgcggcgcgcgttc
gatctcgcggaggcgccgcccgtgcgctggacgctcctccgcaagggcgagcgggagcac
gcgctggcgatcacctgccaccacctcatcgcggacggctggtcgatgaacgtgctcttg
cgggagctcgcgctgatctacggcgcgctcgcggcggggcgcgctccggagctcgcgccg
ctgccgatccagccggcggatcacgcgctgtggcagcgccggaccgagcaggcggcggcg
cgcgagcgggagctcgcgtactttcgcgagcggctgaaggggcctgtgccgcccctctcg
ctcccgacggatcgaccgcggccgtcggtgcagagctacgcgggcgcgcgcgaggagctc
gcgctgccgccggagctcgtggcgcggctcaccgcgctcgggcggggggcgggcgcgacg
ctgttcacgacggtggcggcggggctgttcgcgctgctgcaccggtacacgggccagagc
gacgtctgcatcggcacgccggtcgcggcgcggccgcgggcggccctggagggggccgtc
ggctgcttcctcaacacgctggcgctgcgcgtcgacctcgcgggcaatccgcgcgtcgcg
gagctgatcgcccgcgtccgggcggcggtcacggaggggcaggcgcaccaggaggcgccg
ttcgagcgggtgctggaggcgctgtccctcgagcggagcctcagccactcgcccctgttc
aacgtgatgctcgccatggatccggcgcccgagcgggcgccggagatccccggcctgtcg
atcgaggtgcagcgggtggacaccgggacagcgcagttcgatctggcgctcaacctgacc
ctggacggccagggagcgcgcggcgcctgggaatacaacaccgacctcttcgaccgggcc
acggtggcgcgcatggcgcggcacctcgtcgcgatcctcgaggggttcgccgccgcgccg
gaggcccggctgtccgatctgccgatgatggacgcgggcgaacggaggcaggtcctcgcc
ggctggaacgcgacggagcgcgcctatccgggagacctgcgcgtgcacgcgctgttcgag
gcgcaggccgcgcggacgccggacgcgacggcggtgatcttcgaggaccgccgcctgagc
tatcgagagctcgacgcgcgcgccaaccaggtggcccacgccctgcgccgacgcggcgtc
gggcccgacgggctcgtcgccgtcgcggcagagcgctccgtcgagctggtcgtcgccctg
ctcggcgtcctcaaggccggcgccgcctacgtccccatcgaccccgactaccccgccgag
cgcatcgccttcatgctcgacgacgccgccgctcccgtgctcctcacccagtggccggtc
gcctcgcgcctgccgccccaccgcgcacagctgctgtgcctcgacgccgatcgcgctgcg
ctcgacggcgagtcgaccgccaagcccgcggtcgccgtctcgccggacaacctcgcttac
accatctacacctcgggctcgaccggccggcccaagggcgccggcaacacccaccgcggc
ctcttgaatcggctgcagtggatgcaggagcgctacgcgctcaccgccgaagaccgggtg
tttcaaaagacccccttcagcttcgatgtctcggtctgggagttcttctggccgctcatc
accggcgcgggcctcgtcgtcgcccgtcctggcgaccaccgcgacggcgagcggctcatc
gagctcatcgcacgccacggcgtcaccaccgtgcacttcgtccccccgatgctccaggcc
ttcctggagacgcccggcgcctcgtcgtgcgcctcgctgcgacgggtgatctgcagcggc
gaggccctgcccgccgagctcgcgcggcgatgcttcgagcggctccctcacgccgagctc
cacaatctgtacgggcccaccgaggcatccatcgatgtcaccgcctgggcctgccagccg
ctcgacacctccgcctcggtgcccatcggcacccccatcgccaatacccagatctacctc
ctggatcgacacggccatccggtcccggtgggcgtcgccggggagctttacatcggcggc
gtcgggctcgcgcgcggatatcacaatcggcccgcgctcaccgccgagcgcttcgtcccc
gatccgttcggcgccgcgcccggagggcggctgtaccggacaggcgatctggcccgccat
cgccccgacggagccatcgagttcctgggacggctcgaccatcaggtcaagctccgcggc
ctgcgcgtcgagctcggcgagatcgaggcgcggctgctgctccaccccagcgtcggcgag
gccgtcgtcctcgcccgcgacgaggcccacggcggaaagcgcctcgtcgcctacgtcacc
ggccgcgacggcgccaccccggagccagagacgctgcgcgcctggctcgccgacgcgctc
ccggcctacatggtgcccgcccccatcctcccgctcccgcggctgccgctgtcgcccaac
ggaaaggtcgaccgccgcgccctgcccgcgcccgagcaggtgaacgcgccgaccagggcc
acgacgccgccgcggaccgacctcgagcgcgccatcgcggcgatctggagagacgtcctc
tcgactccgcaggtgggcgttcacgacaacttcttcgatctgggcggacactcgctcttg
ctggccaaggtccacagccgcctgcgcgaggaggtggatcgcgcgctgccgatgctggtc
ctgtttcaacaccccaccatcgcgtcgctcgcagcggccttgagccgggaagccagcgag
ccggcgcccgaggagggagagcggagcggggagcgggcgagcgccgcgcaagagcggcgc
ggggagctcttcgcgcggcggcgcggcgggcgcggcgcgctggagaccaagaaatga

DBGET integrated database retrieval system