KEGG   Staphylococcus condimenti: A4G25_09705Help
Entry
A4G25_09705       CDS       T04648                                 

Definition
(GenBank) aldehyde dehydrogenase
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
scv  Staphylococcus condimenti
Pathway
scv00010  Glycolysis / Gluconeogenesis
scv00071  Fatty acid degradation
scv00280  Valine, leucine and isoleucine degradation
scv00310  Lysine degradation
scv00330  Arginine and proline metabolism
scv00340  Histidine metabolism
scv00380  Tryptophan metabolism
scv00410  beta-Alanine metabolism
scv00561  Glycerolipid metabolism
scv00620  Pyruvate metabolism
scv00625  Chloroalkane and chloroalkene degradation
scv01100  Metabolic pathways
scv01110  Biosynthesis of secondary metabolites
scv01120  Microbial metabolism in diverse environments
scv01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:scv00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    A4G25_09705
   00053 Ascorbate and aldarate metabolism
    A4G25_09705
   00620 Pyruvate metabolism
    A4G25_09705
  Lipid metabolism
   00071 Fatty acid degradation
    A4G25_09705
   00561 Glycerolipid metabolism
    A4G25_09705
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    A4G25_09705
   00310 Lysine degradation
    A4G25_09705
   00330 Arginine and proline metabolism
    A4G25_09705
   00340 Histidine metabolism
    A4G25_09705
   00380 Tryptophan metabolism
    A4G25_09705
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    A4G25_09705
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    A4G25_09705
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    A4G25_09705
Enzymes [BR:scv01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     A4G25_09705
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: AMY06182
UniProt: A0A143PCB7
LinkDB All DBs
Position
2030683..2032179
Genome map
AA seq 498 aa AA seqDB search
MSVNARDYIQDSYDLFINGEFVPSESGETLEVTNPSNGEVLTKIARATEKDVDKAVEAVQ
TAFESWSKTPKEERVRMLREIGDKLLERKDHFAMVETLDNGKPIRETSTTDIPLAARHYQ
YFASVIDTDEGTVNDMSEDIMSIIRHEAVGVVGAVVAWNFPMLLATWKVAPALAAGDTVV
LQPSSSTPLSMIEMAKIFQEVLRDGVVNVVTGKGSESGNAIFNHEGVDKLSFTGSTDVGY
KVAEAAAKRIVPATLELGGKSANIILDDANLDLAVEGIQMGILFNQGEVCSAGSRLVVQE
DIYDELISRLKNAFESVKVGDPTDENTQMGSQTGQAQIDKIQSYVDYAKESGAEILTGGH
RLTEGDLGKGHFFEPTLIAVDSSDDKLAQEEIFGPVLTIIKVKDDDEAIKVANNSDYGLA
GGVFTENINRALTIARAVRTGRMWVNTYDQVPEGAPFGGYKKSGIGRETYKGALRNYQQV
KNIFIDTSNQTKGLYDTK
NT seq 1497 nt NT seq  +upstreamnt  +downstreamnt
atgagtgtaaatgcaagagattatatccaagatagttatgatttatttattaatggtgag
tttgtaccgagtgaatcaggagaaacattagaagtaacaaatccatcaaacggagaggta
ttaacaaaaatagcaagagcaactgaaaaagatgtagataaagcagttgaagcagtacag
acagcttttgaaagttggagtaaaacaccgaaagaagaacgcgtacgtatgttgcgtgaa
attggcgataaattattagaacgtaaagatcattttgcaatggtagaaacattagacaat
ggtaagccaattcgtgaaacttcaacaactgatattccgcttgcagcacgtcattatcaa
tactttgcaagcgtaattgatacagatgaaggtactgtgaatgatatgagtgaggatatc
atgagtatcatccgtcacgaagcagtaggggttgtaggtgcagtagttgcttggaacttc
ccaatgttattagctacttggaaagttgcaccggctttagctgctggtgatacagttgta
cttcaaccatcatcatcaacaccattaagtatgattgaaatggctaaaattttccaagaa
gtattacgagatggcgtggtaaacgttgttacaggtaaaggttctgaatcaggtaatgct
attttcaatcatgaaggtgtagataaattatcattcactggttctactgatgtaggttac
aaagttgcagaagctgcagccaaacgcattgtacctgctactttagaacttggtggtaaa
tcagcgaatattattttagacgatgctaacttagatctagctgtagaaggtattcaaatg
ggtatcttattcaaccaaggtgaagtctgcagtgcaggatcaagattagttgttcaagaa
gatatttatgatgaactgatttcacgtctgaaaaatgcatttgaaagtgttaaagttgga
gatcctacagatgaaaatacccaaatgggttctcaaacaggacaagcacaaattgataaa
attcaaagttatgtagattatgctaaagaatcaggcgctgaaattttaacaggtggccat
cgtcttactgaaggcgatttaggtaaaggtcatttctttgaacctacacttattgctgtt
gatagtagtgatgacaaattggcacaagaagaaattttcggccctgtattaacaatcatt
aaagtcaaagatgatgatgaagctattaaagttgctaacaactctgattatggtttagct
ggtggtgtattcacagaaaatatcaaccgtgcattaactattgctcgtgcagtgagaact
ggacgtatgtgggtcaacacttatgaccaagtaccagaaggtgcaccattcggcggttat
aaaaaatcaggtatcggcagagaaacttataaaggcgctttaagaaactatcaacaagtt
aaaaatatctttattgatactagcaaccaaacaaaaggattatatgatacaaaataa

DBGET integrated database retrieval system