KEGG   Staphylococcus condimenti: A4G25_12040Help
Entry
A4G25_12040       CDS       T04648                                 

Definition
(GenBank) aldehyde dehydrogenase
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
scv  Staphylococcus condimenti
Pathway
scv00010  Glycolysis / Gluconeogenesis
scv00071  Fatty acid degradation
scv00280  Valine, leucine and isoleucine degradation
scv00310  Lysine degradation
scv00330  Arginine and proline metabolism
scv00340  Histidine metabolism
scv00380  Tryptophan metabolism
scv00410  beta-Alanine metabolism
scv00561  Glycerolipid metabolism
scv00620  Pyruvate metabolism
scv00625  Chloroalkane and chloroalkene degradation
scv01100  Metabolic pathways
scv01110  Biosynthesis of secondary metabolites
scv01120  Microbial metabolism in diverse environments
scv01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:scv00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    A4G25_12040
   00053 Ascorbate and aldarate metabolism
    A4G25_12040
   00620 Pyruvate metabolism
    A4G25_12040
  09103 Lipid metabolism
   00071 Fatty acid degradation
    A4G25_12040
   00561 Glycerolipid metabolism
    A4G25_12040
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    A4G25_12040
   00310 Lysine degradation
    A4G25_12040
   00330 Arginine and proline metabolism
    A4G25_12040
   00340 Histidine metabolism
    A4G25_12040
   00380 Tryptophan metabolism
    A4G25_12040
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    A4G25_12040
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    A4G25_12040
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    A4G25_12040
Enzymes [BR:scv01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     A4G25_12040
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh VASP_tetra
Motif
Other DBs
NCBI-ProteinID: AMY06620
UniProt: A0A143PE85
LinkDB All DBs
Position
2513536..2514963
Genome map
AA seq 475 aa AA seqDB search
MRIQTKQYINGEWVDSTSGETLDVINPANEEVLGQIAKGNKEDVDKAVDAANDVYLEFRH
SSAEFRRDLLDKIVQEYKNRKDDIIEAITDELGSPLEISKNVHYEMGLAHFTEARDALDK
FEFEEKRGDDLVVKEAIGVAGLITPWNFPTNQTSLKLAAAFAAGSPVVLKPSEMTPFAAI
ILAEIFDKVGVPKGVFNLVNGDGEGVGNPLSENPKVRMMSFTGSGPTGSKIMKKAADDFK
KVSLELGGKSPYIILDDSDIEGAAEAAVGKVYNNTGQVCTAGTRTIVPESMKDDFIKAAK
EKMSQVKVGDPREKGVQMGPIISKKQFDQVEDYIQKGIDEGAELVLGGVGKPEGLEKGYF
AKPTIFANVTNDMTIAQEEIFGPVMSIITYKDLNEAIKIANETKYGLAGYVYGKDLNTLR
KVAREIEAGTIEINEAGRKPDLPFGGYKQSGIGREWGDYGIEEFLEIKSIAGYYE
NT seq 1428 nt NT seq  +upstreamnt  +downstreamnt
ttgagaattcaaactaaacaatatatcaatggcgaatgggtagatagtacaagcggtgaa
acacttgatgttattaaccctgccaatgaagaagtattaggccaaattgcaaaaggcaat
aaagaagatgtagataaagcagtagatgctgcaaacgatgtttaccttgaattccgtcac
agtagtgcagaatttagaagagatttattagataaaattgtacaagagtataaaaataga
aaagatgacattatagaggctattactgatgaattaggttcacctcttgaaatttctaaa
aatgttcattatgaaatgggacttgctcactttactgaagcaagagatgcattagataaa
tttgaatttgaagaaaaacgcggtgatgatttagttgtgaaagaagcaattggtgtagca
ggattaatcacaccttggaacttcccaactaatcaaacatcattaaaattagcagctgca
ttcgcagcaggttctccagttgtattgaaaccttctgaaatgacaccgtttgctgcaatt
attttagcagaaatcttcgacaaagttggcgtaccgaaaggtgtcttcaacttagtaaat
ggtgatggcgaaggtgtcggcaacccactaagtgaaaatccgaaagtacgtatgatgtca
tttactggttctggtccaactggttctaaaattatgaaaaaagctgcagacgacttcaag
aaagtatcattagaattaggcggtaaatcaccatatattattcttgatgattcagatatt
gaaggcgcagctgaagctgcagtaggcaaagtttataataatactggtcaagtttgtact
gcaggtacacgtacaatcgttccagaatcaatgaaagatgacttcattaaagctgctaaa
gaaaaaatgagccaagttaaagtcggagaccctagagaaaaaggtgttcaaatgggtcca
atcatcagtaaaaaacaattcgatcaagttgaagattatatccaaaaaggtatcgatgaa
ggcgctgagcttgtattaggcggtgtcggcaaacctgaaggattagaaaaaggttatttc
gctaaaccaactatcttcgcaaatgtgactaatgatatgacaattgctcaagaagaaatc
tttggtcctgtaatgtcaattatcacttacaaagatttaaacgaagcaattaaaatcgca
aatgaaactaaatatggtcttgctggatatgtttacggtaaagacttgaatactttaaga
aaagtagcacgtgaaattgaagcaggaacaattgaaatcaatgaagctggtcgcaaacca
gacttaccattcggcggttacaaacaatcaggaattggtcgcgaatggggcgactacgga
attgaagaattcctagaaatcaaatcaattgcaggatattatgaataa

DBGET integrated database retrieval system