KEGG   Streptomyces cyaneogriseus: TU94_10405Help
Entry
TU94_10405        CDS       T03687                                 

Definition
(GenBank) aldose epimerase
  KO
K01785  aldose 1-epimerase [EC:5.1.3.3]
Organism
scw  Streptomyces cyaneogriseus
Pathway
scw00010  Glycolysis / Gluconeogenesis
scw00052  Galactose metabolism
scw01100  Metabolic pathways
scw01110  Biosynthesis of secondary metabolites
scw01120  Microbial metabolism in diverse environments
scw01130  Biosynthesis of antibiotics
Module
scw_M00632  Galactose degradation, Leloir pathway, galactose => alpha-D-glucose-1P
Brite
KEGG Orthology (KO) [BR:scw00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    TU94_10405
   00052 Galactose metabolism
    TU94_10405
Enzymes [BR:scw01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.3  aldose 1-epimerase
     TU94_10405
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldose_epim TAT_signal
Motif
Other DBs
NCBI-ProteinID: AJP01864
UniProt: A0A0C5G133
LinkDB All DBs
Position
2542834..2543982
Genome map
AA seq 382 aa AA seqDB search
MELSRRTVIAGAAAAGLAAATTAGPAHATGGRKPVKELFGKLADGTKVHRWSLENGGTRM
KVLSYGGVVQSLEIPDRRGRYANVSAGFDDLDDYVARSPHFGALIGRYGNRIAKGRFTLD
GTTYQLSVNDGENSLHGGALGFDYRVWDVEPFTEGSDVGLRLRYTSADGEMGYPGTLKAK
VTYTLTRFGDWRIDYEATTDKATVVNLTSHVYWNLAGEGSGTIEDHELSIAASRFTPTDA
GLIPTGELAKVAGTPFDFRRAKPIGRDIRAGHPQLVLAKGFDHNWVLDKGVTARPEHIAT
LRDPSSGRTLRIATDQPGLQFYSGNFLDGTLTGPGGSVYRQGDALCLETQHFPDSPNQPS
FPSTVLRPGQTYRSTTVHTFGA
NT seq 1149 nt NT seq  +upstreamnt  +downstreamnt
atggaactgagcagacgcacggtcatcgcgggcgccgccgcggcgggcctcgccgccgcc
accacggccggccccgcacacgccacgggaggcaggaagccggtgaaggaactcttcggg
aagctcgccgacgggacgaaggtccaccgctggtcgctggagaacggcggcacgcggatg
aaggtcctctcctacggcggcgtcgtgcagtccctggagatccccgaccggcgcggccgg
tacgcgaacgtctccgcgggcttcgacgacctcgacgactacgtggcccgcagcccgcac
ttcggcgccctgatcggccggtacggcaaccgcatcgccaagggccgcttcaccctggac
ggcacgacgtaccagctctccgtcaacgacggcgagaactccctgcacggcggcgccctc
ggcttcgactaccgggtgtgggacgtcgagccgttcaccgagggctccgacgtcggcctc
cgcctgcgctacaccagcgccgacggcgagatgggctacccgggcacgctgaaggcgaag
gtcacctacaccctcacccgcttcggcgactggcgcatcgactacgaggccaccaccgac
aaggccaccgtcgtcaacctcaccagccacgtctactggaacctggccggcgagggcagc
ggcaccatcgaggaccacgagctgtcgatcgccgcctcccgcttcacgcccaccgacgcg
ggcctgatccccaccggcgagctggccaaggtcgcgggcaccccgttcgacttccgccgg
gccaagccgatcggccgggacatccgcgccgggcacccgcagctcgtcctggccaagggc
ttcgaccacaactgggtgctggacaagggcgtcaccgcccgcccggagcacatcgccacc
ctgcgcgacccgtcctccggccgcaccctgcggatcgccaccgaccagccgggcctgcag
ttctactccggcaacttcctcgacggcaccctgaccggccccggcggctccgtctaccgg
cagggcgacgccctgtgcctggagacccagcacttcccggactccccgaaccagccgtcg
ttcccctcgaccgtgctgcgcccggggcagacgtaccggtcgacgacggtgcacacgttc
ggcgcctga

DBGET integrated database retrieval system