KEGG   Streptomyces cyaneogriseus: TU94_14975Help
Entry
TU94_14975        CDS       T03687                                 

Definition
(GenBank) aldehyde dehydrogenase
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
scw  Streptomyces cyaneogriseus
Pathway
scw00010  Glycolysis / Gluconeogenesis
scw00053  Ascorbate and aldarate metabolism
scw00071  Fatty acid degradation
scw00280  Valine, leucine and isoleucine degradation
scw00310  Lysine degradation
scw00330  Arginine and proline metabolism
scw00340  Histidine metabolism
scw00380  Tryptophan metabolism
scw00410  beta-Alanine metabolism
scw00561  Glycerolipid metabolism
scw00620  Pyruvate metabolism
scw00625  Chloroalkane and chloroalkene degradation
scw00903  Limonene and pinene degradation
scw01100  Metabolic pathways
scw01110  Biosynthesis of secondary metabolites
scw01120  Microbial metabolism in diverse environments
scw01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:scw00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    TU94_14975
   00053 Ascorbate and aldarate metabolism
    TU94_14975
   00620 Pyruvate metabolism
    TU94_14975
  09103 Lipid metabolism
   00071 Fatty acid degradation
    TU94_14975
   00561 Glycerolipid metabolism
    TU94_14975
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    TU94_14975
   00310 Lysine degradation
    TU94_14975
   00330 Arginine and proline metabolism
    TU94_14975
   00340 Histidine metabolism
    TU94_14975
   00380 Tryptophan metabolism
    TU94_14975
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    TU94_14975
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    TU94_14975
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    TU94_14975
Enzymes [BR:scw01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     TU94_14975
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh Tox-ODYAM1
Motif
Other DBs
NCBI-ProteinID: AJP02595
UniProt: A0A0C5G225
LinkDB All DBs
Position
complement(3624969..3626429)
Genome map
AA seq 486 aa AA seqDB search
MSSYFTDLAQQYIDGDWRPGTGSWDIIDFNPYDNEKLASITIATVDEVDAAYRAAERAQK
QWAVTSPYARRAVFEKALKLVEEREREITEAIIAELGGTHLKAAFELHLAKEFLREAVHL
ALRPEGRIIPSPIDGKENRVYRVPVGVVGVISPFNFPFLLSLKSVAPALALGNGVVLKPH
QNTPIVGGTLIGKIFEDAGLPGGLLNVVVTDIAEIGDTFLEHPVPKVISFTGSDQVGRHV
ATVCASHFKRSVLELGGNSALVVLDDADIDYAVDAAVFSRYVHQGQVCMAANRILVDRSV
SEEFTAKFVAKVRSLKVGDPSDPETIIGPVINSQQADALTATVEQALAEGATALVHGTTT
DNLVEPSVLTGIPAGSALLKREVFGPVAFLVPFDGEEEAVRIVNDTPYGLSGAVHTGNIE
RGVRFAQRIDTGMFHVNDGTVHDEPIVPFGGEKHSGLGRLNGETMLDAFTTQKWISVQHG
RSGFPF
NT seq 1461 nt NT seq  +upstreamnt  +downstreamnt
atgtcgtcgtacttcacggacctggctcagcagtacatcgacggtgactggcgcccgggt
accggttcctgggacatcatcgacttcaacccgtacgacaacgagaagctggcgtcgatc
accatagccacggtcgacgaggtcgacgccgcctaccgggccgccgagcgcgcccagaag
cagtgggcggtgaccagcccgtacgcccgccgcgcggtgttcgagaaggcgctgaagctg
gtcgaggagcgcgagcgggagatcaccgaggcgatcatcgccgagctgggcggcacccac
ctcaaggccgccttcgagctgcacctcgccaaggagttcctgcgcgaggcggtccacctg
gcgctgcggcccgagggccggatcatcccctcgcccatcgacggcaaggagaaccgcgtc
taccgggtgcccgtcggcgtcgtgggcgtgatcagccccttcaacttccccttcctgctc
tccctgaagtcggtcgccccggccctcgccctcggcaacggcgtcgtcctcaagccgcac
cagaacacgccgatcgtcggcggcaccctgatcggcaagatcttcgaggacgccggcctg
cccggcggtctgctcaacgtcgttgtcacggacatcgcggagatcggcgacacgttcctg
gagcacccggtccccaaggtcatctccttcaccggctccgaccaggtcggccgtcacgtc
gccaccgtctgcgcctcccacttcaagcgctcggtcctggaactgggcggcaacagcgcc
ctggtggtcctcgacgacgccgacatcgactacgcggtcgacgccgccgtcttcagccgg
tacgtccaccagggccaggtctgcatggccgccaaccgcatcctggtcgaccggtcggtt
tccgaggagttcaccgcgaagttcgtcgccaaggtcaggtcgctgaaggtgggcgacccg
agcgacccggagacgatcatcggcccggtgatcaactcgcagcaggcggacgcgctcacg
gccaccgtcgagcaggcgctcgccgagggcgcgacggccctggtgcacggcacgaccacc
gacaacctcgtcgagccgtccgtcctcaccggcatccccgccggctccgccctgctcaag
cgggaggtgttcggcccggtcgccttcctcgtccccttcgacggcgaggaggaggccgta
cgcatcgtcaacgacaccccctacggcctgagcggggcggtccacaccgggaacatcgag
cgcggggtgcgcttcgcccagcggatcgacaccggcatgttccacgtgaacgacggcacc
gtccacgacgagccgatcgtccccttcggcggggagaagcactccggtctcggccggctg
aacggcgagacgatgctggacgccttcaccacccagaagtggatctcggtgcagcacggg
cggagcggcttccccttctag

DBGET integrated database retrieval system