KEGG   Streptomyces cyaneogriseus: TU94_22675
Entry
TU94_22675        CDS       T03687                                 

Definition
(GenBank) multidrug ABC transporter ATP-binding protein
  KO
K01990  ABC-2 type transport system ATP-binding protein
Organism
scw  Streptomyces cyaneogriseus
Brite
KEGG Orthology (KO) [BR:scw00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:scw02000]
    TU94_22675
Transporters [BR:scw02000]
 ABC transporters, prokaryotic type
  ABC-2 type and other transporters
   ABC-2 type transporter
    TU94_22675
SSDB
Motif
Pfam: ABC_tran AAA_21 AAA_23 AAA_29
Other DBs
NCBI-ProteinID: AJP05837
UniProt: A0A0C5G0E3
LinkDB
Position
complement(5377742..5378707)
AA seq 321 aa
MIELEGLTKRYGEKVAVNNLTFAVRPGIITGFLGPNGAGKSTTMRMVLGLDRPTAGDVRI
DGNHYDELKDPLKYIGALLDAKAVHGGRSAYHHLLCLAQANGIPAKRVHEVLDVVGLTAV
AKKKAKGFSLGMGQRLGIAAALLGDPRILMFDEPVNGLDPEGIHWIRNLMKALAAQGRTV
FVSSHLMSEMALTADHLVVIGQGRLLADTSMADFIAQNSRSYVRIRTPQREQLLDVLNEA
GITVAGSGSEVLEVDGDKSERIGELAAQHQIVLHELSPQQASLEEAFMRLTAESVEYHAH
GGQPAGQRQAQQEWGSEWRRG
NT seq 966 nt   +upstreamnt  +downstreamnt
atgatcgagctcgaggggctgacgaagcggtacggcgagaaggtggcggtcaacaatctc
acttttgccgtcagacccggcatcatcacgggctttctcgggcccaatggtgcgggcaag
tcgaccacgatgcggatggtgctggggctcgaccggcccaccgcgggggatgtgcggatc
gacggcaatcactacgacgagctcaaggacccgctgaagtacatcggcgccctgctggac
gccaaagcggtgcacggcgggcgcagtgcctaccaccacctgctgtgcctggctcaggcc
aacggcattccggccaaacgggtgcacgaggtgctggacgtcgtcggcctgacggcggtc
gcgaagaagaaggccaagggcttctcgctgggtatggggcagcggctgggcatcgccgcg
gcgctgctgggcgacccgcggatcctgatgttcgacgagcccgtcaacggcctcgacccc
gagggcatccactggatccgcaatctgatgaaggcgctggccgcgcagggccggacggtc
ttcgtctcctcccatctgatgagcgagatggcgctgaccgccgaccatctggtcgtcatc
ggtcagggccggctgctcgccgacacctcgatggccgacttcatcgcgcagaactcgcgc
agttacgtgcggatccgcaccccgcagcgcgagcagttgctcgacgtgctgaacgaggcg
gggatcacggtcgccgggagcggctcggaagtgctggaggtggacggcgacaagtcggag
cggatcggcgagctggccgcgcagcaccagatcgtgctgcacgaactgtcgcctcagcag
gcatcgctggaggaggcgttcatgcggctgaccgcggagtcggtggagtaccacgcccac
ggcgggcagcctgccgggcagcggcaggcgcagcaggagtggggcagcgagtggaggagg
ggctga

DBGET integrated database retrieval system