KEGG   Streptomyces cyaneogriseus: TU94_27150Help
Entry
TU94_27150        CDS       T03687                                 

Definition
(GenBank) aminotransferase class III
  KO
K00823  4-aminobutyrate aminotransferase [EC:2.6.1.19]
Organism
scw  Streptomyces cyaneogriseus
Pathway
scw00250  Alanine, aspartate and glutamate metabolism
scw00410  beta-Alanine metabolism
scw00640  Propanoate metabolism
scw00650  Butanoate metabolism
scw01100  Metabolic pathways
scw01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:scw00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    TU94_27150
   00650 Butanoate metabolism
    TU94_27150
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    TU94_27150
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    TU94_27150
Enzymes [BR:scw01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     TU94_27150
Amino acid related enzymes [BR:scw01007]
 Aminotransferase (transaminase)
  Class III
   TU94_27150
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Beta_elim_lyase
Motif
Other DBs
NCBI-ProteinID: AJP04588
UniProt: A0A0C5G3Q2
LinkDB All DBs
Position
6468652..6469938
Genome map
AA seq 428 aa AA seqDB search
MTRDLLSRHRAVLPDWLALYYEDPVEITHGEGRHVWDAAGNRYLDFFGGILTTMTAHALP
EVTKAVSEQAGRLLHSSTLYLNRPMVELAERVAHLSGIPDARVFFTTSGTEANDTALLLA
TTYRRSNTVLAMRNSYHGRSFGAVGITGNRGWSPTSLSPLQTLYVHGGVRTRGPYAALGD
REFIDACVADLVDLLGHTRPPAALIAEPVQGVGGFTSPPDGLYAAFREVLRERGILWIAD
EVQTGWGRTGDHFWGWQAHARSGPPDIVTFAKGIGNGMSIGGVIARAEIMNCLDANSIST
FGGTQVTMAAGLANLTYLLEHDLQGNARRVGGLLIERLRSVAAQVPHVREVRGRGLMIGI
ELTRPGTDEADWQAASAVLEAARAGGLLIGKGGGHDTSALRIAPPLSLTVAEAEEGAAIL
ERALRSLE
NT seq 1287 nt NT seq  +upstreamnt  +downstreamnt
gtgacccgcgacctgctgagccgccaccgcgccgtcctgcccgactggctcgccctctac
tacgaggacccggtcgagatcacccacggcgagggccgccacgtctgggacgccgccggc
aacaggtacctggacttcttcggcggcatcctcaccaccatgaccgcgcacgccctgccc
gaggtgaccaaggcggtgagcgagcaggccgggcggctcctgcactcctcgaccctctat
ctcaaccgccccatggtcgaactggccgaacgcgtcgcccacctgtccggcatccccgac
gcccgggtcttcttcaccacctccggcaccgaggccaacgacaccgccctgctgctggcg
acgacgtaccggcgcagcaacaccgtcctcgcgatgcgcaacagctaccacggccgctcc
ttcggcgcggtcggcatcaccggcaaccgcggctggtcacccacgtcgctctccccgctc
cagacgctgtacgtccacggcggcgtgcgcacgcgcgggccctacgccgcgctcggcgac
cgggagttcatcgacgcctgcgtcgccgacctcgtcgacctgctcggccacacccgcccg
ccggccgccctgatcgccgaacccgtccagggcgtcggcggcttcacctccccgccggac
ggcctctacgccgccttccgggaggtgctgcgcgagcgcggcatcctgtggatcgccgac
gaggtgcagaccggctggggccgcaccggcgaccacttctggggctggcaggcccacgcc
cgcagcggcccgcccgacatcgtcaccttcgccaagggcatcggcaacggcatgtccatc
ggcggggtgatcgcccgcgccgagatcatgaactgcctggacgcaaacagcatctccacc
ttcggcggcacccaggtcaccatggcggccggcctcgccaatctgacgtacctgctggaa
cacgacctccagggcaacgcccggcgggtcggcggactgctcatcgagcggctgcggtcc
gtcgccgcccaggtgccgcacgtgcgcgaggtgcgcggacggggactgatgatcggcatc
gagctgacccggcccggcaccgacgaggcggactggcaggccgcgtccgccgtgctggag
gcggcccgcgcgggcggcctgctcatcggcaagggcggcggccacgacaccagcgccctg
cggatcgccccgccgctgtccctcacggtcgcggaggcggaggagggcgccgcgatcctg
gagcgcgccctgagaagcctcgagtag

DBGET integrated database retrieval system