KEGG   Streptomyces cyaneogriseus: TU94_28735Help
Entry
TU94_28735        CDS       T03687                                 

Definition
(GenBank) 4-carboxymuconolactone decarboxylase
  KO
K14727  3-oxoadipate enol-lactonase / 4-carboxymuconolactone decarboxylase [EC:3.1.1.24 4.1.1.44]
Organism
scw  Streptomyces cyaneogriseus
Pathway
scw00362  Benzoate degradation
scw01100  Metabolic pathways
scw01120  Microbial metabolism in diverse environments
scw01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:scw00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    TU94_28735
Enzymes [BR:scw01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.24  3-oxoadipate enol-lactonase
     TU94_28735
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.44  4-carboxymuconolactone decarboxylase
     TU94_28735
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Abhydrolase_1 CMD Abhydrolase_6 Hydrolase_4 Abhydrolase_4 Ndr Esterase Ser_hydrolase
Motif
Other DBs
NCBI-ProteinID: AJP04837
UniProt: A0A0C5FXM8
LinkDB All DBs
Position
complement(6815517..6816644)
Genome map
AA seq 375 aa AA seqDB search
MNDTLLHHRAEGPASAPPLLLGPSLGTSLALWDKVAPELSSGHRVIRWDLPGHGGSPAGL
LRAGATVGDLADRVLALADALGVERFAYAGVSLGGAVGLHLALHHPERVSSLAVICSSAH
FNGARPWQDRAALVRREGLAHLAESADARWFTPGFTVPRLVQDHRDADPEAYAACCDALA
AFDVRDRLGGIAAPTLVIAGREDPATPPAHLREIADAVPGATLVEIPGASHLAPAERPEA
VLAALRSHLDGPAKRGMAVRRAVLGDAHVDRAQARQTPFTAPFQDFISRYAWGEIWTDET
LSRRERSMITLTALVAHGHYEELAMHVRAARRNGLTPEEIGAVLLQTAVYCGVPAANSAF
ATAQRVLAEEDGGAG
NT seq 1128 nt NT seq  +upstreamnt  +downstreamnt
ttgaacgacaccctcctccatcaccgtgccgaaggccccgcttccgctcccccgctgctg
ctcggaccctcgctcggcacctccctcgccctgtgggacaaggtggcgcccgagctgtcc
agcggccaccgggtgatccgctgggaccttccgggccacggcggttccccggccgggctg
ctccgcgccggtgccaccgtcggcgacctcgccgatcgggtgctggcgctcgccgacgcg
ctcggcgtggagcggttcgcctacgcgggggtgtcgctgggcggcgcggtcgggctccat
ctggccctgcaccacccggagcgggtctcctcgctcgcggtcatctgctcgtcggcgcac
ttcaacggggcgcggccgtggcaggaccgggcggcgctggtccggcgcgagggcctggcc
cacctcgccgagagcgcggacgcccgctggttcacccccggcttcaccgtgccgcggctg
gtccaggaccaccgcgacgccgaccccgaggcgtacgccgcctgctgcgacgcgctggcc
gcgttcgacgtgcgcgaccggctcggcggcatcgccgcgcccaccctcgtgatcgccggg
cgcgaggaccccgccacgcccccggcccatctgcgggagatcgccgacgcggtgccgggc
gccaccctggtggagatcccgggcgcctcccatctggcgccggcggagcgcccggaggcc
gtcctggcggcgctgcggagccacctcgacgggcccgccaagcggggcatggcggtgcgg
cgcgcggtgctgggcgacgcgcacgtggaccgggcacaggcccggcagacccccttcacc
gcccccttccaggacttcatctcgcgctacgcgtggggggagatctggaccgacgagacg
ctctcccgccgcgagcgcagcatgatcacgctgacggcgctggtggcgcacggccactac
gaggaactggccatgcatgtgcgggcggcgcgccgcaacgggctcacacccgaggagatc
ggcgcggtgctgctccagaccgccgtgtactgcggggtcccggcggcgaactcggcgttc
gccacggcccagcgggtgctggcggaggaggacggcggcgccggctga

DBGET integrated database retrieval system