KEGG   Streptomyces cyaneogriseus: TU94_28785Help
Entry
TU94_28785        CDS       T03687                                 

Definition
(GenBank) ATP-dependent DNA ligase
Organism
scw  Streptomyces cyaneogriseus
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_C RNA_ligase
Motif
Other DBs
NCBI-ProteinID: AJP04847
UniProt: A0A0C5FXN9
LinkDB All DBs
Position
complement(6825131..6826216)
Genome map
AA seq 361 aa AA seqDB search
MELPVMPPVKPMLAKSVAKIPPGMQYEAKWDGFRAIVFRDGPEVELGSRTTKPLTRYFPE
LVTAVRERLPERCVLDGEIVIAREGRLDFDALTERIHPADSRVRMLAERTPASFVAFDLL
ALDGESLLDVALADRRALLVRALAEVAAPVHVAPATTDVEVARHWFEQYEGAGLDGVVAK
PLDLRYLQDERAMFKVKHERTADVVVAGYRFHKSGPVVGSLLLGLYDERGALQHVGVSAA
FSMKRRAELVEELEPLRLDDVSGHPWAAWADEAAHETARLPGAPSRWSGKKDLSWVPLRP
ERVAEVAYDHMENGARFRHTARFRRWRPDRTPESCTYAQLEEPVRYDLAEIFAPPAKSSR
G
NT seq 1086 nt NT seq  +upstreamnt  +downstreamnt
atggagctgccggtcatgccgcccgtgaagccgatgctcgccaagtccgtggcgaagatc
ccgccgggcatgcagtacgaggcgaagtgggacggtttccgggcgatcgtcttccgcgac
ggcccggaggtcgagctcggcagccgcaccaccaagccgctgaccaggtattttcccgag
ctggtgacggccgtgcgggagcggctgcccgagcggtgcgtgctggacggggagatcgtg
atcgcgcgggagggccggctggacttcgacgcgctgaccgagcgcatccatccggccgac
tcccgggtgcggatgctggcggagcggacgccggcctccttcgtcgccttcgacctgctg
gcgctggacggcgagtccctgctcgacgtggcgctcgccgaccggcgggcgctgctggtc
cgggcgctcgccgaggtcgccgccccggtgcacgtggcgcccgcgacgaccgacgtcgag
gtggcgcggcactggttcgagcagtacgagggcgcggggctggacggtgtcgtcgccaag
ccgctggacctgcgctacctccaggacgagcgggccatgttcaaggtcaagcacgagcgg
acggcggacgtggtggtggccggctaccggttccacaagagcgggcccgtcgtcggttcg
ctgctgctcggcctgtacgacgagcgcggcgccctccagcacgtgggcgtgtccgccgcc
ttctccatgaagcggcgggccgagctggtggaggagctggagccgctgcgcctggacgac
gtctcggggcacccctgggcggcgtgggcggacgaggcggcgcacgagacggcgcggctg
ccgggcgcgccgtcccgctggtccggcaagaaggatctgtcctgggtgccgctgcggccg
gagcgggtcgccgaggtggcctacgaccacatggagaacggggcgcgcttccggcacacg
gcccgcttccgccgctggcgccccgaccgcacgccggagagctgcacctacgcccagctg
gaggagccggtgcgctacgacctcgcggagatcttcgcgccgccggcgaagtcctcgcgg
ggctga

DBGET integrated database retrieval system