KEGG   Streptomyces cyaneogriseus: TU94_29350Help
Entry
TU94_29350        CDS       T03687                                 

Gene name
tdh
Definition
(GenBank) L-threonine 3-dehydrogenase
  KO
K00060  threonine 3-dehydrogenase [EC:1.1.1.103]
Organism
scw  Streptomyces cyaneogriseus
Pathway
scw00260  Glycine, serine and threonine metabolism
scw01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:scw00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    TU94_29350 (tdh)
Enzymes [BR:scw01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.103  L-threonine 3-dehydrogenase
     TU94_29350 (tdh)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C FAD_binding_3 AlaDh_PNT_C Methyltransf_25 HI0933_like FAD_binding_2 Pyr_redox_3 Pyr_redox_2 FAD_oxidored 3HCDH_N Trp_halogenase Pyr_redox I-EGF_1
Motif
Other DBs
NCBI-ProteinID: AJP04944
UniProt: A0A0C5G9C4
LinkDB All DBs
Position
6969725..6970753
Genome map
AA seq 342 aa AA seqDB search
MKALVKQKAEPGLWLTDVPEPAVGPGDVLIKVLRTGICGTDLHIRAWDGWAQQAIRTPLV
VGHEFVGEVVGTGRDVTDVKVGDRVSGEGHLVCGKCRNCLAGRRHLCRATVGLGVGRDGA
FAEYVALPASNVWVHRVPVDLDVAAIFDPFGNAVHTALSFPLVGEDVLITGAGPIGLMAA
AVARHAGARNVVVTDVSEERLELARKVGASLALNVSGTTIADGQRELGLREGFDIGLEMS
GRPEALRDMIANMTHGGRIAMLGLPSEEFAVDWARVVTSMITLKGIYGREMFETWYAMSV
LLEGGLDLGPVITGRYACHDFEAAFADAASGKGGKVILDWTA
NT seq 1029 nt NT seq  +upstreamnt  +downstreamnt
ttgaaggcgctggtcaagcagaaggcggagcccgggctctggctcacggacgtccccgag
cccgccgtcgggcccggcgacgtactcatcaaagtgctgcgcaccggcatctgcggcacc
gacctgcacatccgggcctgggacggctgggcgcagcaggccatccgcaccccgctcgtc
gtcggccacgagttcgtgggcgaggtcgtcgggaccgggcgggacgtcaccgacgtcaag
gtcggcgaccgggtcagcggggagggccacctggtctgcggcaagtgccgcaactgtctg
gccggccgccgccacctgtgccgggccacggtcggtctcggcgtcggccgggacggggcg
ttcgccgagtacgtcgccctgcccgcgtccaacgtgtgggtgcaccgcgtcccggtcgac
ctcgacgtcgcggcgatcttcgacccgttcggcaacgccgtgcacaccgccctgtccttc
ccgctggtcggggaggacgtgctgatcaccggggccgggccgatcggcctgatggccgcg
gccgtcgcccggcacgccggtgcccgcaacgtcgtggtcaccgatgtcagcgaggagcgg
ctggagctggcccgcaaggtcggcgcgagcctggccctgaacgtgtccggcaccacgatc
gccgacgggcagcgcgagctgggtctgcgggagggcttcgacatcggtctggagatgtcc
ggccgccccgaggcgctgcgggacatgatcgccaacatgacgcacggcggccggatcgcg
atgctcggcctgccgtcggaggagttcgcggtcgactgggcccgcgtcgtcacctcgatg
atcaccctcaagggcatctacggccgggagatgttcgagacctggtacgcgatgtcggtg
ctgctggagggcggcctcgacctcggccccgtgatcaccggccgctacgcctgccacgac
ttcgaggcggcgttcgccgacgcggcgagcggcaagggcggcaaggtcatcctcgactgg
accgcgtaa

DBGET integrated database retrieval system