KEGG   Streptomyces cyaneogriseus: TU94_30625Help
Entry
TU94_30625        CDS       T03687                                 

Definition
(GenBank) peptide synthetase
Organism
scw  Streptomyces cyaneogriseus
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Condensation AMP-binding PP-binding AMP-binding_C
Motif
Other DBs
NCBI-ProteinID: AJP05974
UniProt: A0A0C5GC94
LinkDB All DBs
Position
7293843..7313864
Genome map
AA seq 6673 aa AA seqDB search
MTSSKRNRAEALPEDLREALRRRLAGRAGTAPGTTVRQGIPRADRTRPLPLSFAQQRLWF
LDRLRPGDARYNSAVALRLTGPLDRDALGRALDTVVARHEALRTTFEEGEDGRPVQRVHE
PGPVPLPVRDTAPPETDAALLAEYARPFDLRTGPLLRALLLRESGHAHVLLLTAHHIVTD
GWSMGVVLEELCTAYDALAHGEPVQLPPVAAQYPDFAVWQRDQLSGARLERELAHWTERL
RGAVPPELPLDRPRRGEESGAGAVHTFTVPADVTARLRALAAEQHTTLFTSLVAACQALL
ARWSGQADSTVGSLTPGRSRTDLERAVGFFASTVVLRTPVHTGDSFRALLTAAADTVNDA
FAHGDTPFERLVEAVGATREAGRNPLFDVMVLLHPAPPAAPALRDVTTAPVAVPRQAATF
DLSVEFVPDGERLTGLLEYRTDFIDADTAHRMTEQLQRLLAGVAAEPDRPLGTLPLLSGT
DVRRVTRDWNDTARPVPATLVPRLFEERAARTPHATALVAGGERLDYATLNARANRLAHH
LIARGAGPEQLVALRLPRTADMITGILAVWKAGAAYLPLDLALPEDRVRHLLDDARPALV
LDEAALRAVPGPGDTGPEETGPDTDPTDADRRAPLDPGHPAYVIHTSGSTGRPKGVAVAH
RSLANLLAAHREGFVAEAGGGPLNVALTASFSFDTSLEGVLLMADGHPLHLVDETTRLDA
AALVEYVVEHRIDFLDLTPSYLRQLLPAGLLADERHRPRVLMVGGEAVGPGLWRELAARR
DVAAYNFYGPTECTVDALSCRIEGERRPLVGRPLPNVRAYVLDDRLQPVPPGVGGELYLA
GEQVARGYLGRPGLTAARFVADPFGAPGTRMYRTGDLARWTADGRLDYLGRADDQVKVRG
HRIEPGEVEAALLDLPELTAAAVVAVADARGHTRLAAYVVPAAGAAAPAASGLRAALRRV
LPDHMVPSSFTVLDALPLTVNGKLDRRALPAPDVASGPGEREYTAPRTPAERTLAGIWAE
VLGLDRVGVTDNFFELGGDSILSIQAVSRARAAGLHLTSQDVFRHQTVADLAAAAAPRTP
AAPAPRAPRPSGPAPLTPVQEWFFAAHGPLRHFSMSMLLDLPHDLDERALEQAVEAVAVR
HPALRTRFARTGTTWRQHPGEGPATGLLTRHDLSAAPDPATARARAADAARAALDPATGS
LFRAALLLPAPGERPQLFLTAHHLAVDGVSWRVLLTGLEQAYRQAAAGGPVRLAPEETPF
AAWAAHLSERVRAGDLDADLPYWTAEAAQPRTPLPVDRPGTPRAASVRTVRTRVDGPTTE
ALLRRVPGVYRTQVNDVLLSALGRVLADWAGADRITVALEGHGREDVGEPHDLSRTVGWF
TTQYPVTLTPAGPAGAPDWGATLKAVKERLRSVPRRGLSHEALARLGSPDPAARALRDVP
LPQVSFTYHGQWETPGSGEFAQSAEVPGREIAADEPLDHLLDVSAAVVDGTLEITWHYSA
EVHDERTVRRLADGMAAALAAITEHCARPDAGGRTPSDFPLARLDQAGVDRLAGDGRGVE
DLLPLTPLQEGMLFHRLVGGGDDVYVDQAALLLRGVADPHAFALAWQRVTDRTPALRTSV
VWEDVPVPLQVVHRHVEVPVTHLDWREVDPGERAERLERLREDDLARGIDLATAPLMRLT
LVRLPDAELRLLWTSHHLILDGWSLAQVLTEVCEEYAALTAGVESRPPVRRPFGDYVRWL
AEQDAGAAREHWRGVLTGFATPTPLPAGGVPRETHRTRSAAVHTAGLSDAVSERLARTAR
ESGLTLSTVVQGAWALLLARYGAEEDVVFGTTVSGRPDDLPGAESMVGMFINTLPTRVRV
DARRPAADWLRELQRAQADARRFAAVSLAELTSLSDVPPGSPLFHTMVAFENYPFDEART
ATSGVRLAGVDSRDATNYPLVLRAYQGERIGFDLAYDPGLLDHGTVRELAARLCLLLAGI
ADGVDRPLRALPWTTAEERRLLPAAGNGTAHGRPGRTLVDLFEEQAARTPAALAVTCAGE
HLDYATLDARANRLAHRLAEAGARPERYVALSLPRGLDQIVAILAVLKTGAAYLPVDPSV
PAERLAAVLDDARPVTLVTTTRTAARAGTTAVPVLPLDDPRVAADLAGRPDTGPDPAHRP
LPEHPAYAIYTSGSTGRPKGVVVPHANVVRLFTRTAHWFGFGPQDVWTLFHSYAFDFSVW
ELWGALLHGGRLVVVPEDVARSPEDFLRLLADEGVTVLNQTPSAFHPLTRADAEHPSTGD
RLALRTVIFGGEALDTGRLTGWYERHPEDAPRLVNMYGITETTVHVTHAPLDGATAATGG
ASPIGTGIPDLRVYVLDSTLAPVPPGAVGEMYVAGEGLARGYLGRPGLTATRFVADPFGA
PGTRMYRTGDLARRRADGTLEYLGRADQQVKIRGYRIEPGEIEAALHTHPGVGAAAVGVH
EDAGGTRRLVAHVVGTGSGDGAAAPPSAAELRAHLERLLPAHMVPAAYVPLPALPLTVNG
KLDRRALPAPGPDGFATAGDRVPPRTPAERLVAAAWADVLDTEEVGADDDFFALGGDSLL
AVRVTARLRAAFGADVSPRLLFTHPTVAALAAELGEPAGGSPEAIPAADPDAPAPLSYAQ
QRLWFLDRFEPGSTEYTTLSVLRLRGPLDGSALRTALDGLVARHEALRTTFAEQDGHARQ
VIHPPHPVPLPADDLTGRGEQALDALVEREAATAFDLATGPLLRARLARLAPDEHVLVLA
VHHIVTDGWSVAVLGRDLGELYAAARDHRAPDLPALPVRYADFAAWQRARTDRAERDLAH
WRRTLEGLAPLELPTDRPRPAVRTRDGALVTFHLPPELTDRLRAAGRTADATLYMTLLTA
CQILLARWAEQEDIAVGTVTAGRERAELHDVVGMFVNTLVLRARVRPELSFRELLRQART
TVLDAFAHQEVPFEQVVDALQPERDTSRTPLFQVMVALHNLGAQAPALPGLEVEPVTPPV
RHAAFDLAFDFVERDGGLTGYLEYSTGLFDADTAERLADRLRLLLQAAAEDPDRPAGALP
LLTEAERHRVLHDWQGARLPVPDTAFTALFETQAARTPDATAVVARDATYDFAALNARAN
RLAHHLIALGAGPEDVVAVRLPRTGDSLVALLAVLKSGAALQWIDPDLPAERVALLLEDT
GARTVLTPDALRAVPWDRLPAHDPTDADRRRPLSPYDTAYVIHTSGSTGRPKGVAVEHRQ
LINLCLDHRDGLLAPHTADGRRLRAALSASFSFDTSWEGPLLLALGHQVHLVDEDTRLDP
EAFCAQIADHGLDFVNVTPSFLRELLAAGLLAPGRHHPRLLLVGGEAVDAATWRELRAAR
DLGVHAYNMYGPTETTVDAVYGPCADGPDRPVIGRPGRNLRAYVLDGSLRPVPPGMPGEL
YLAGPQVARGYLNRPAQTAARFLADPFGAPGERMYRTGDRARWDADGRLEFLGRADEQVK
IRGFRIEPGEVEAALLAHPDVADAAVAAREQAGRALLAAYLVPAGDRVPPADELRVWLRR
TLPGHMVPAAFVPLARIPRTSSGKTDRRALPAPPAQPDSTTPYVAPRPGTEETLAAIWAQ
VLGVERVGARDNFFTLGGDSILSIQIVSRARQAGLALTTKDVFRHQTVAELALSVTETAP
PPTAAPAPAEAPLTPIQHWYLDDRRPGDRLRFTMTQRLSLAPDTDAEALQRAVEALVEHH
PALRTRFRHTADGWRQEVLSEAPDGVFTRHTGPAAEEEVQRAVDTAQSSLDPVGGRVVRA
LLFDGDPAQLVLTLHHLAVDGVSWRILLADLETAYRDAVAGRPVALPPAGTAYTTWATRL
EEHTRSGALDADLEYWTRTCAAPAELPPGRSGPNTHGTAATVTVTLEPEETDALLRRVPD
AYRTQVNDVLLSALGRALARWCGRDTVLVGVEGHGREDLGDGFEADLSRTVGWFTAEFPL
ALTVAPDAGWHDTLRSVKEQLRAVPGRGVSHGALRHLVPGSPLAGTPRPRVGFNYHGRWD
AGGATGDGPLRAALPPAGRDTDPDEERPYLLDITGVVQDGRLELGWTYPPAVYDESVVRR
LAEDMCAALREIVAHCARPDSGGRTPSDFPFAGLTQEQVDRLVGNGRHVDDVLPLTPLQS
GMLFHGLVDTAGAYFDRTAVRLSRVADPRAFAAAWQQVADHTPALRTSVHWRGLPHPVQV
VHRDVELPVTHLDWRALTPRQRAEATERLLAEDHAAGMDLTRAPLTRLTLAALPGDEVLL
VWSTHHIVLDGWSTGQLLTEVCERYAALTGGPAAAPPVRRPFADFLRWLAEREEKDAAAA
ERYWADALAGFTARTPLPYDRTPAEAHRARSAAAAHRELDEHLSLRLRQTAARAGLTVNT
VVQGAWALLLARTSGRRDVVFGTTVSGRPAELPGVETMIGMFINTVPTRVRVPSGGVRDW
LRGVQEEQSAARHHDFLALPRIQALGDVPAGEALFDSMVVFENYPVDESVTARTGVAVEE
VRADDATTFPLCLRAHLGDRLGFDLAYDAALFDTATVERTAARLAVLLTALAAGLDGDVD
DLELLTDEDRRVLDGWNTTARSLPPRSPVGLFAEQARRTPGAVAVRDGDRELTYQGLDEW
SDRVAAHLLAGGLAPEDRVALLMDRGAELVVAQVAVLKAGGAYVPVDARAPEERIRTLLE
QAGATVRLTAREVAACARTTPARPLPAADPDRLAYVMFTSGSTGRPKAVAVRHRDVASLA
TDSRFADGVCARVLLHSPVAFDAATFEVWAPLLTGGCVVVAPGETVDAALVRRLAADGGL
TALWLTAGLFRLLAQDAPDCFTGLRQVWTGGDVVPAAAVRRVLAACPGLTVVDGYGPTET
TTFATAHALTDAEAVPATVPIGTPLDDLRVYVLDSRLRPVPPGCAGELYVSGEGVARGYL
GRPGDTAARFLADPCGPPGARMYRTGDLARRGPDGTVEFLGRADDQVKIRGFRVEPGEVE
AVLAGHPAVADVAVVAREDRPGARRLVAYVVGDAGRDPDDLRAFARRTLPDYLVPSAVVP
LPALPLSANGKVDRAALPAPADDAERGPGPRTRPRTEAERRTADAFAEVLGTERPGVDDD
FFRLGGDSLLSIRLASRLAEAFGTDVSPRAVFDHPTPAALAALLTAPGTGPARPALVPVA
REAAAPMSYAQQRLWFLEEFAPGGAEYVTALALRLRGTLDTGALARALRSVVARHESLRT
TFDSADGHGVQIVHPPHDVPLPLHDLSGLPGAEREARLEALLTAERTRPFDLRRGPLLRA
ALVRLDGDHHVLALVVHHIVTDGWSTAVLTGDLAHFYRAETGTAGGELPPLPVQYADYAH
WQRTALGTAGEDHLAYWKQRLAGVEPLDLPTDRPRPPVRTADGATTRLVLPPRTARRLAR
AGRERGATLFTTLVAAAQVYLARLSGGQDIAVGTVTAGRDLPETQNLVGFFVNTLVLRSE
VRPEQTFPEFVTAVRQTVRDAFAHQDVPFERVVDEVQPVRDTSRTPLFQVMVVLQNTPSA
ELDLPGLEVTDVETELRHAAFDLTLEFAETETGALHGLLTYNTGLFDPATAERMAEQLGT
LLTALAEDPDRPVGTLPLTTDAELKALLDQGHGTARPVPAATLPRLFERQAARTPDAIAL
ADGARQWTYAQADRAANRLAHRLIARGAGPETVVALALPRGAAAVVAQLAVTKAGGAFLP
VDPDYPEQRRRFMIRDAGAALVLDDPEEVWAAGGPDTAPTDADRTAPLTPHHPAYVIYTS
GSTGTPKGVVVTHSGLAAFAAAAAERYAAGPGDRVLQFASPSFDASVLELCVSLLTGATL
VTGEEGPLVGERLAQVLAERRISHTLIPPAALATVPAEWATALPELRTLIVGAEACPADL
VERWAPGRRMINSYGPTEATVVATWTGPLAPGAGAPPIGRPAGAARVYVLDAALRPVPPG
VLGELYVAGPGLARGYLDRPGLTASRFVPDPFGAPGERMYRTGDLVRWDADGQLRFAGRA
DAQVKLRGFRIEPGEIEAALRRTARVRDAVVVVRDDETTGTARLVAYVVPATGDDGHPGA
RPHDGRTGPGEEQAAPGEEPAGPREELAGLREELAGHLPPHMVPSVFVPLRRLPLTPNGK
LDRSALPAPGPAAAHGGPRTAPRTDTERRVARVWADVLGVPEVGADDNFFHLGGDSILSL
QVVSRLRREGLHIATRDLFTHQTVAELAAVVRTGPQRSGDGPVSGDVPLTPIQEWFLTTP
RAAHHHFNQSLLLELEGTPDPAALETALAALLTHHDALRMRFTRDADGWHQFNPPPAEDR
DVLVRHDLTGLAPDEADAAMERAADELHAGFALEDGPLLRAGLFTGGPGRPAFLLLVAHH
LVVDAVSWRILRDDLEAAYRQAVRGEPVVLGERTTSYRDWARGLAAHVAGGSLDHELPYW
EEAVAAEPVPGPALPDAGESRALTVELGEEDTEALLRSAPTAYRTRVNDVLLAALALALA
RWTGGERVRLDLEGHGREDLLDGVDLSRTVGWFTTVHPVALRVDAPDDLGPARDWRALVK
SVRRQLRAVPGNGIGFGALRTYGPPEVRERLGGAASHGQVVFNYLGQWDARPAGDDAPGT
GLIRAEHGSLGRDHDPRDGGSHLLEVVGAVQHGRLAFTWHHRPAVHDTATVRRVAGEFAE
ALRHIARHARGVR
NT seq 20022 nt NT seq  +upstreamnt  +downstreamnt
atgacgtcttcgaagcgaaaccgcgccgaggccctgcccgaggacctcagagaagcactg
cgccgccggctggccggacgcgccgggaccgcgcccgggaccaccgtccgccagggcatc
ccgcgcgccgaccgcacccgcccgctgccgctctccttcgcccagcagcggctgtggttc
ctggaccggctgcgccccggcgacgcccgctacaacagcgccgtcgcactgcggctcacc
ggccccctggaccgggacgccctcgggcgcgccctggacaccgtcgtcgcccgccacgag
gccctgcggaccaccttcgaggagggcgaggatgggcgccccgtacagcgcgtccacgaa
cccggccccgtcccgctgccggtgcgcgacaccgccccgccggagacggacgcggccctg
ctcgccgagtacgcccgccccttcgacctgcgcaccggcccgctgctgcgcgccctgctg
ctgcgcgagtccggccacgcgcacgtcctgctgctgacggctcatcacattgtcaccgac
ggctggtcgatgggggtggtgctggaggaactgtgcaccgcctacgacgccctggcgcac
ggggagccggtgcagctgccgccggtggcggcccagtacccggacttcgcggtgtggcag
cgcgaccagctctccggcgcgcgcctggagcgcgaactggcccactggacggagcgactg
cgcggcgccgtgccgcccgagctgcccctggaccggccgcgccgcggcgaggagtccggg
gcgggcgcggtgcacaccttcaccgtccccgccgacgtcaccgcccggctgcgcgccctc
gccgccgagcagcacaccaccctgttcacctcgctggtcgccgcctgccaggcgctgctg
gcccgctggtccgggcaggccgacagcaccgtcggctccctgaccccgggccgctcccgc
accgacctggagcgggccgtcggcttcttcgccagcaccgtcgtcctgcgcaccccggtg
cacaccggtgactccttccgcgccctgctgacggcggccgccgacaccgtcaacgacgcc
ttcgcgcacggcgacacgccgttcgagcggctggtggaggcggtcggcgccacccgcgag
gcgggccgcaaccccctcttcgacgtgatggtcctgctgcacccggccccgcccgcggcc
cccgccctgcgcgatgtcaccaccgccccggtcgccgtgccccggcaggcggccaccttc
gacctcagtgtcgagttcgtgccggacggggagcggctgaccggcctgctggagtaccgc
accgacttcatcgacgcggacaccgcccaccggatgaccgagcagttgcagcgcctcctc
gcgggcgtcgccgccgagcccgaccgccccctcggcaccctcccgctgctctccgggacg
gacgtccgccgggtcacccgggactggaacgacaccgcccgcccggtccccgccacgctc
gtgccgcggctcttcgaggaacgcgcggcccgcaccccgcacgccaccgccctggtcgcc
ggcggcgaacgcctcgactacgccaccctcaacgcccgcgccaaccgcctggcccaccac
ctcatagcccgcggggccggccccgagcagctcgtcgccctgcgcctgccccgcaccgcc
gacatgatcaccggcatcctcgccgtgtggaaggcgggcgccgcctacctccccctcgac
ctcgccctccccgaggaccgcgtacgccacctcctcgacgacgcccgccccgccctcgtc
ctcgacgaggccgcgctgcgcgccgtccccggcccgggggacaccggcccggaggagacc
ggcccggacaccgaccccaccgacgccgaccggcgcgcccccctcgaccccggccacccc
gcctacgtcatccacacctccggctccaccggccgccccaagggcgtcgccgtggcccac
cggtcgctggccaacctgctcgccgcgcaccgagagggattcgtcgccgaggccggcggc
ggaccgctcaacgtggcgctcaccgcgtcgttctccttcgacacctcgctggagggcgtg
ctgctgatggccgacggccacccgctgcacctcgtcgacgagacgacccggctggacgcg
gcggccctggtggagtacgtcgtcgagcaccgcatcgacttcctcgacctgaccccctcc
tacctgcgccagttgctgcccgccgggctgctcgccgacgagcgccaccgcccccgggtg
ctcatggtcggcggcgaggccgtcggcccgggcctgtggcgcgagctggccgcccggcgg
gacgtcgccgcgtacaacttctacggccccaccgagtgcaccgtcgacgccctgtcctgc
cggatcgagggcgagcgccgccccctggtgggccgcccgctgcccaacgtacgggcctac
gtcctcgacgaccggctccagccggtgccgcccggcgtcggcggcgagctgtacctggcg
ggcgagcaggtggcccgcggctacctgggccgcccgggcctgaccgcggcccggttcgtc
gccgatccgttcggggcgcccggcacccgcatgtaccgcaccggcgacctggcccgctgg
accgcggacggccggctcgactacctcggacgcgccgacgaccaggtgaaggtgcgcgga
caccgtatcgagcccggcgaggtcgaggcggccctgctggacctgccggagctgaccgcc
gccgcggtcgtcgcggtggccgacgcgcgcggccacacccggctcgccgcctacgtggtc
cccgccgccggggccgccgcacccgccgcctccggcctgcgcgccgcgctgcgccgcgtg
ctgcccgaccacatggtgccgtcgtcgttcaccgtcctcgacgcgctgccgctgaccgtc
aacggcaagctggaccgccgcgccctgcccgcccccgacgtcgcctcgggccccggcgag
cgggagtacaccgccccgcgcacccccgccgagcggacactggccggcatctgggccgag
gtactgggcctggaccgggtcggcgtcaccgacaacttcttcgagctgggcggcgactcc
atcctcagcatccaggccgtctcccgcgcccgcgccgccgggctccacctgacctcgcag
gacgtcttccgccaccagaccgtcgccgacctcgccgccgcggcggccccgcgcaccccc
gccgcaccggcgccccgggcgccccgcccgagcggaccggcaccgctgacccccgtccag
gagtggttcttcgccgcgcacggcccgctgcgccacttcagcatgtcgatgctgctcgac
ctgccccacgacctcgacgaacgggccctggagcaggcggtggaggcggtcgccgtccgg
caccccgcgctgcgcacccggttcgcgcgcaccggcaccacctggcggcagcaccccggc
gagggccccgccaccgggctgctcacccgccacgacctgtccgccgcccccgacccggcc
accgcccgcgcccgggccgccgacgccgcccgcgccgccctcgacccggccaccggcagc
ctcttccgggccgccctgctgctgcccgccccgggcgagcgcccgcagctcttcctgacc
gcccaccacctcgccgtggacggcgtctcctggcgcgtgctcctcaccggcctggaacag
gcgtaccggcaggcggccgcgggcggacccgtccggctcgctccggaggagacacccttc
gccgcgtgggccgcccacctgtccgagcgggtgcgggccggcgacctcgacgccgacctg
ccgtactggaccgccgaggccgcccagccgcgcaccccgctccccgtcgaccggcccggt
acgccgcgcgcggcgtcggtgcgcaccgtgcgcacccgggtggacggccccaccaccgag
gcgctgctgcgccgggtccccggcgtgtaccgcacccaggtcaacgacgtcctgctgagc
gccctcggccgggtgctcgccgactgggcgggcgccgaccggatcaccgtcgcgctggag
ggacacggccgggaggacgtcggcgagccgcacgacctctcgcgcaccgtgggctggttc
accacccagtacccggtcaccctcaccccggccggcccggccggcgcgcccgactggggc
gccacgctgaaggcggtcaaggagcggctgcggtccgtgccccggcgcggcctgagccat
gaggcgctggcccggctcggctcacccgaccccgccgcccgcgcgctgcgcgacgtgccg
ctgccccaggtgtccttcacctaccacggacagtgggagacgcccgggtccggggagttc
gcccagtccgccgaggtgcccggccgggagatcgccgccgacgagcccctggaccacctg
ctggacgtctccgccgccgtcgtcgacggcacactggagatcacctggcactacagcgcg
gaggtccacgacgagcggaccgtacggcggctcgcggacggcatggccgcggcgctggcc
gcgatcaccgagcactgcgcccgcccggacgccggcggccgcaccccgtccgatttcccg
ctggcccgcctcgaccaggccggcgtggaccggctggccggcgacgggcgcggcgtcgag
gacctcctgccgctgaccccgctgcaggagggcatgctcttccaccgcctggtcggcggc
ggcgacgacgtctacgtggaccaggcggcgctgctgctgcggggcgtggccgacccgcac
gccttcgcgctcgcctggcagcgggtgaccgaccgcacccccgcgctgcgcacctcggtg
gtctgggaggacgtgcccgtgccgctccaggtcgtgcaccggcacgtcgaggtgcccgtc
acccacctggactggcgcgaggtggaccccggcgagcgcgccgaacggctggagcggctg
cgcgaggacgacctggcccgcggcatcgacctcgccacggccccgctgatgcggctgacc
ctcgtccggctgcccgacgccgagctgcggctgctgtggacctcgcaccacctgatcctg
gacggctggagcctggcccaggtgctcaccgaggtgtgcgaggagtacgccgccctgacc
gccggcgtcgagagccggccgccggtgcgccgccccttcggggactacgtgcgctggctc
gccgagcaggacgccggtgccgcccgcgagcactggcggggcgtgctcaccgggttcgcc
acaccgaccccgctgcccgcgggcggcgtgccgcgcgagacccaccggacccggtcggcg
gccgtgcacaccgccgggctgtccgacgcggtctccgagcggctggcccgcaccgcgcgg
gagtccgggctcaccctgagcaccgtggtgcagggcgcctgggcgctgctgctcgcccgc
tacggcgccgaggaggacgtggtgttcggcaccaccgtctccggccgccccgacgacctg
cccggcgccgagtccatggtcggcatgttcatcaacacgctgcccacccgggtccgcgtg
gacgcccgccgcccggccgccgactggctgcgcgaactccagcgggcccaggccgacgcc
cgccggttcgccgccgtctccctggccgagctgacctcgctgagcgacgtgccgccgggc
agcccgctgttccacaccatggtcgccttcgagaactaccccttcgacgaggcccgcacc
gccacctccggcgtgcgcctggccggcgtcgactcccgcgacgccaccaactacccgctg
gtgctgcgcgcctaccagggcgagcggatcggcttcgacctcgcctacgaccccggcctg
ctcgaccacggcaccgtgcgggaactcgccgcccggctctgcctgctgctggccgggatc
gccgacggcgtcgaccgcccgctgcgcgccctgccctggaccaccgccgaggagcggcgc
ctgctgccggccgctggcaacggcaccgcccacggccgtcccggccggaccctggtggac
ctcttcgaggagcaggccgcccgcacccccgccgccctcgccgtcacctgcgccggcgag
cacctcgactacgccacgctcgacgcccgcgccaaccgcctggcccaccggctcgccgag
gccggtgcccggccggagcgctatgtcgcgctgtccctgccccgcggcctggaccagatc
gtggcgatcctcgcggtgctgaagaccggcgccgcctatctgcccgtcgacccctccgtg
cccgccgagcggctggccgccgtcctcgacgacgcgcgccccgtgacgctggtgacgacc
acgcggactgcggcccgggccgggaccaccgccgtgcccgtgctgccgctggacgacccg
cgggtggccgccgacctcgccggccgcccggacaccggcccggaccccgcccaccgcccc
ctgccggagcaccccgcctacgccatctacacctccggctccaccggccgccccaagggc
gtcgtggtgccgcacgccaacgtggtgcgcctgttcacccgcaccgcgcactggttcggc
ttcggcccccaggacgtgtggacgctgttccactcctacgccttcgacttctccgtgtgg
gagctgtggggcgcgctgctgcacggcgggcggctcgtcgtcgtccccgaggacgtcgcc
cgctccccggaggacttcctgcggctgctggccgacgaaggggtcaccgtcctcaaccag
accccgtccgccttccaccccctcacccgcgccgacgccgaacacccctcgaccggggac
cggctcgccctgcgcacggtgatcttcggcggcgaggcattggacaccgggcggctcacc
ggctggtacgagcggcaccccgaggacgcgccccgcctggtcaacatgtacggcatcacc
gagacgaccgtgcacgtgacccacgccccgctggacggcgccaccgccgccacgggtggt
gcgagccccatcggcaccggcatccccgacctgcgggtgtacgtcctcgacagcaccctg
gcacccgtaccgcccggcgcggtgggggagatgtacgtggcgggggagggactggcccgc
ggctacctcggccggcccggactgaccgcgacccgcttcgtcgccgacccgttcggggcg
ccggggacccgcatgtaccgcaccggcgacctggcccggcggcgcgccgacggcaccctg
gagtacctgggccgcgccgaccagcaggtcaagatccgcggctaccgcatcgagcccggc
gagatcgaggccgcgctgcacacccacccgggcgtcggcgcggcggccgtaggcgtccac
gaggacgccggcggcacccggcggctggtcgcccacgtcgtgggcaccggcagcggggac
ggcgccgccgccccgccctccgccgccgagctgcgcgcccacctggagcgcctgctgccc
gcccacatggtgcccgccgcctacgtaccgctgcccgcgctgccgctcacggtcaacggc
aaactcgaccggcgcgccctgcccgcccccggtcccgacggcttcgccacggccggcgac
cgcgtcccgccgcgcacccccgccgaacgcctcgtcgccgccgcctgggcggacgtcctg
gacaccgaggaggtcggcgccgacgacgacttcttcgccctcggcggcgactccctgctc
gccgtgcgcgtcaccgcacggctgcgcgcggccttcggcgcggacgtctccccccggctg
ctgttcacccacccgacggtcgccgcgctcgccgccgagctgggtgaaccggccggtggc
tcgcccgaggcgataccggccgcggacccggacgccccggccccgctgtcgtacgcccag
caacgcctgtggttcctcgaccggttcgagccgggcagcaccgagtacacgacgctgtcc
gtgctgcggctgcgcggcccgctcgacggcagcgccctgcgcaccgccctggacggcctg
gtcgcccggcacgaggccctgcgcaccaccttcgccgagcaggacggccacgcccggcag
gtgatccacccgcctcaccccgtcccgctgccggccgacgacctgaccggccggggcgaa
caggccctcgacgcgctggtcgagcgggaggccgccaccgccttcgacctggcgaccggc
ccgctgctgcgtgcccgcctcgcccgtctggcccccgacgagcacgtgctcgtcctcgcc
gtgcaccacatcgtcaccgacggctggtccgtcgccgtcctcggccgcgacctgggcgag
ctgtacgcggcggcccgcgaccaccgcgcccccgacctgcccgcgctcccggtccgctac
gccgacttcgccgcctggcagcgtgcgcgcaccgaccgggccgagcgggacctcgcccac
tggcgcaggaccctggaggggctggccccgctggagctgcccaccgaccggccccggccc
gccgtccgcacccgcgacggcgccctggtcaccttccatctgccgcccgagctgaccgac
cggctgcgcgcggccggccgcaccgccgacgccaccctctacatgacactgctgacggca
tgtcagatactgctggcccgctgggccgagcaggaggacatcgccgtcggcaccgtcacc
gccggccgcgagcgggccgaactgcacgacgtcgtcggcatgttcgtcaacaccctggtg
ctgcgcgcccgggtgcggcccgagctgtcgttccgggagctgctgcgccaggcgcgcacc
accgtgctggacgcgttcgcccaccaggaggtgcccttcgagcaggtggtggacgccctc
cagcccgagcgggacaccagccgcaccccgctgttccaggtcatggtcgcgctgcacaac
ctgggcgcccaggcccccgccctgcccggcctggaggtcgaaccggtcaccccgccggtc
cgccacgccgccttcgacctcgccttcgacttcgtcgagcgggacggcggcctcaccggc
tacctggagtacagcaccggcctgttcgacgcggacaccgccgaacgcctcgccgaccgg
ctccggctgctgctccaggccgccgccgaggacccggaccgcccggccggcgcgctgccg
ctgctcaccgaggccgaacggcaccgggtcctgcacgactggcagggcgcccggctgccg
gtgccggacaccgccttcaccgccctgttcgagacgcaggccgcccgcaccccggacgcg
accgccgtggtggcccgcgacgccacctacgacttcgccgcgctcaacgcgcgcgccaac
cgcctcgcccaccacctcatcgccctcggggccggccccgaggacgtggtcgcggtacgc
ctgccgcgcaccggcgactcgctggtcgcgctgctggcggtgctcaagtcgggtgccgcc
ctccagtggatcgacccggacctgcccgccgaacgcgtggcgctgctgctggaggacacc
ggggcccggacggtgctgacccccgacgccctgcgcgccgtgccctgggaccggctgccc
gcccacgaccccaccgacgccgaccgccgccggccgctgagcccgtacgacaccgcctac
gtcatccacacctccggctccaccggccgccccaagggcgtcgccgtcgaacaccgccag
ctcatcaacctctgcctcgaccaccgcgacggcctcctcgccccgcacaccgccgacggc
cgccggctgcgcgccgcgctcagcgcctccttctccttcgacacctcctgggagggaccg
ctgctgctggccctcggccaccaggtgcacctcgtcgacgaggacacccgcctggacccg
gaggcgttctgcgcgcagatcgccgaccacggactggacttcgtcaacgtcaccccgtcc
ttcctgcgcgaactcctcgccgccggcctcctcgcccccggccgccaccacccccgcctg
ctgctcgtcggcggcgaggcggtcgacgccgccacctggcgggagctgcgcgccgcgcgg
gacctcggcgtgcacgcgtacaacatgtacggccccaccgagaccaccgtcgacgcggtc
tacggcccctgcgccgacggccccgaccggccggtgatcggccgccccggccgcaacctg
cgcgcctacgtcctcgacggttccctcaggccggtgccgcccggcatgcccggcgagctg
tacctggccgggccgcaggtggcccgcggctatctgaaccggcccgcgcagaccgccgcc
cgcttcctcgccgacccgttcggtgcgccgggggagcggatgtaccgcaccggtgaccgc
gcccgctgggacgccgacggacggctggagttcctcggccgggccgacgagcaggtcaag
atccgcgggttccgcatcgagcccggcgaggtggaggccgcgctcctcgcccacccggac
gtcgccgacgcggccgtggccgcccgcgagcaggcgggccgcgccctgctcgccgcctac
ctggtacccgccggggaccgcgtcccgcccgccgacgaactgcgcgtgtggctgcgccgt
accctgcccggccacatggtgcccgccgcgttcgtgccgctcgcccgcatcccgcgcacc
agcagcggcaagaccgaccggcgcgcgctgcccgccccgcccgcacagcccgacagcacc
accccgtacgtggcgccgcgccccggcaccgaggagacactggcggcgatctgggcgcag
gtcctcggcgtggaacgggtcggcgcccgggacaacttcttcaccctgggcggcgactcg
atcctcagcatccagatcgtctcccgcgcccgccaggccggcctcgccctgacgaccaag
gacgtcttccgccaccagacggtcgccgaactcgccctgtccgtcaccgagaccgcaccc
ccgcccaccgcggccccggcaccggccgaggcgccgctcacccccatccagcactggtac
ctcgacgaccgccgcccgggcgaccgtctgcgcttcaccatgacccagcgcctgagcctg
gccccggacacggacgctgaggcgctccaaagggcggtcgaggcgctcgtggagcaccac
ccggccctgcgcacccggttccggcacaccgcggacggctggcgccaggaggtcctgtcc
gaggccccggacggcgtcttcacccgccacaccggaccggcggcggaggaggaggtccag
cgcgcggtggacaccgcgcagagctccctcgacccggtcgggggccgggtggtgcgggcc
ctgctcttcgacggcgaccccgcccagctcgtcctcaccctccaccacctggccgtcgac
ggtgtctcctggcgcatcctgctcgccgacctggagaccgcctaccgcgacgccgtggcc
ggccggcccgtcgccctgcccccggcgggcaccgcgtacaccacctgggcgacccggctg
gaggagcacacccgctccggagccctggacgccgacctggagtactggacccgcacctgc
gccgccccggccgagctgccccccggccggtccggccccaacacccacggcaccgccgcc
accgtcaccgtgacgctggagccggaggagaccgacgcgctgctgcgccgcgtccccgac
gcctaccgcacccaggtcaacgacgtgctgctgagcgccctgggccgcgccctggcccgc
tggtgcgggcgcgacaccgtcctggtcggcgtcgaggggcacggccgggaggacctgggc
gacggcttcgaggcggacctgtcgcgcacggtcggctggttcaccgccgagttccccctc
gccctgaccgtcgcgcccgacgccgggtggcacgacaccctgcgctcggtcaaggagcag
ttgcgcgcggtgccgggccgcggagtgagccacggcgccctgcgccacctcgtgcccggc
agcccgctggccggcaccccccgcccccgggtcggcttcaactaccacggccggtgggac
gcgggcggcgcaaccggcgacggaccgctgcgcgccgcgctgccccccgcgggccgcgac
accgacccggacgaggaacgcccctacctgctggacatcaccggcgtcgtccaggacggc
cgtctcgaactgggctggacctacccgcccgccgtctacgacgagtccgtcgtgcgccgc
ctcgccgaggacatgtgcgcggccctgcgcgagatcgtcgcgcactgcgcccgcccggac
tccggcggccgcaccccctccgacttcccgttcgccgggctcacccaggagcaggtggac
cgcctcgtcggcaacgggcgccacgtggacgacgtgctgccactgacccccctccagtcc
ggcatgctcttccacggcctggtcgacaccgcgggcgcctacttcgaccgcaccgcggta
cggctgtcccgcgtcgcggacccgcgggcgttcgccgccgcctggcagcaggtcgccgac
cacaccccggccctgcgcaccagcgtccactggcggggcctgccgcaccccgtgcaggtc
gtccaccgcgacgtggaactgcccgtcacccacctcgactggcgggcgctgacaccccgg
cagcgcgccgaggcgaccgagcggctgctggccgaggaccacgccgccggcatggacctc
acccgcgccccgctcacccgcctcaccctggccgccctgcccggcgacgaggtgctgctg
gtgtggtccacccaccacattgtcctcgacggctggagcaccggccagttgctcaccgag
gtgtgcgagcgctacgccgccctcaccggcggccccgccgcggccccgccggtgcgcagg
ccgttcgcggacttcctgcgctggctcgccgagcgggaggagaaggacgccgccgcggcc
gagcggtactgggccgacgccctcgccggcttcaccgcccgcaccccgctgccgtacgac
cgcacccccgccgaggcgcaccgcgcccgctccgccgccgccgcccaccgcgaactggac
gagcacctctcactccggctgcggcagacggccgcccgcgccggactcaccgtcaacacc
gtcgtccagggcgcctgggcgctgctgctcgcccgcaccagcggacggcgcgacgtggtc
ttcggcaccaccgtctccgggcgcccggccgaactccccggcgtcgagacgatgatcggc
atgttcatcaacaccgtgcccacccgggtgcgggtgccgtccggcggggtgcgggactgg
ctgcgcggcgtgcaggaggaacagagcgccgcccggcaccacgacttcctcgccctgccg
cgcatccaggccctcggcgacgtcccggcgggggaggcgctcttcgacagcatggtggtc
ttcgagaactaccccgtcgacgagtccgtcaccgcccgcaccggcgtggccgtcgaggag
gtgcgcgccgacgacgccaccaccttccccctgtgcctgcgcgcccacctcggcgaccgg
ctcggattcgacctcgcctacgacgccgcgctgttcgacaccgccacggtggagcgcacc
gcggcccggctcgccgtcctgctcaccgcgctcgccgccggactcgacggggacgtggac
gacctggagctgctgaccgacgaggaccggcgggtgctggacgggtggaacaccaccgcc
cgcagtctcccgccgcgcagcccggtcggcctcttcgccgagcaggcccgccgcaccccc
ggcgcggtcgcggtccgcgacggtgaccgcgagctgacctaccaagggctcgacgagtgg
tccgaccgggtggccgcccacctgctcgcgggcgggctggctcccgaggaccgcgtcgcc
ctgctcatggaccgcggcgccgaactcgtcgtcgcccaggtggcggtgctcaaggcgggc
ggcgcctacgtcccggtggacgcccgcgcccccgaggagcggatccggaccctgctggag
caggcgggagcgacggtacggctcacggcccgggaggtggccgcctgcgcgcggacgacg
cccgcccggccccttcccgccgccgaccccgaccgcctcgcctacgtcatgttcacctcc
ggctccaccggccgccccaaggcggtcgccgtgcgccaccgggacgtggcgtcgctcgcg
accgacagccggttcgccgacggggtgtgcgcccgggtgctgctgcactcgccggtggcg
ttcgacgcggccaccttcgaggtgtgggcaccgctgctgaccggcgggtgcgtggtcgtg
gcacccggggagaccgtggacgcggcactggtgcggcggctggccgcggacggcggcctg
accgcgctgtggctgacggccggcctcttccgcctgctcgcccaggacgccccggactgc
ttcacgggcctgcgccaggtgtggaccggcggtgacgtggtccccgcggcggccgtgcgc
cgggtcctggccgcctgccccggcctgaccgtggtcgacggctacggaccgacggagacc
accaccttcgccaccgcgcacgccctcaccgacgccgaggccgtccccgccaccgtgccc
atcggcacgcccctggacgacctgcgcgtgtacgtcctcgactcccggctgcgccccgtc
ccgccgggctgcgccggtgagctgtacgtctccggcgagggcgtggcccgcggctacctc
ggccgccccggcgacaccgccgcccgcttcctcgccgacccctgcggcccgcccggcgcc
cgcatgtaccgcaccggcgacctcgcccggcgcggcccggacggcacggtcgagttcctg
ggccgggccgacgaccaggtcaagatccgcggcttccgcgtcgaacccggagaggtggag
gcggtcctcgccggccaccccgcggtcgcggacgtcgcggtggtggcccgcgaggaccgg
ccgggggcccggcggctggtcgcctacgtcgtcggggacgccggccgggacccggacgac
ctgcgcgccttcgcccgccgcaccctgcccgactacctcgtcccctccgccgtcgtcccg
ctcccggcgctcccgctcagcgccaacggcaaggtggaccgggcggcgctcccggccccg
gcggacgacgcggagcgcgggcccggaccgcgcacccggccgcgcaccgaggccgaacgc
cgtaccgcggacgccttcgccgaggtgctgggcaccgagcggcccggcgtggacgacgac
ttcttccggctgggcggcgactccctcctcagcatccgcctggcctcgcgcctggccgag
gcgttcggcaccgacgtctccccgcgcgccgtcttcgaccaccccaccccggccgcgctc
gccgccctgctcaccgcacccggcaccggcccggcccggcccgccctggtgccggtcgcc
cgcgaggcggcggcccccatgtcgtacgcgcagcaacgcctgtggttcctggaggagttc
gcgcccggcggcgcagagtacgtcaccgccctcgccctgcggctgcgcggcaccctcgac
accggcgccctggcccgcgccctgcggtccgtggtggcccggcacgagtcgctgcgcacc
accttcgactcggccgacggccacggcgtgcagatcgtgcacccgccgcacgacgtgccc
ctgcccctgcacgacctgtccggcctgcccggagccgaacgcgaggcccgcctcgaagca
ctcctcaccgccgaacgcacccggcccttcgacctgcgccgcggcccgctgctgcgcgcc
gcgctggtgcggctggacggcgaccaccacgtcctggcgctcgtcgtgcaccacatcgtc
accgacggctggtccaccgccgtcctcaccggcgacctggcccacttctaccgggccgag
accggcacggccggtggtgaactgcccccgctgcccgtgcagtacgccgactacgcgcac
tggcagcgcaccgccctcggcaccgcgggcgaggaccacctggcgtactggaagcagcgg
ctggccggcgtcgaaccgctcgacctgcccaccgaccggccgcgcccgccggtgcgcacc
gcggacggcgccaccacccgcctggtgctgccgccgcgcaccgcccgccggctggcccgg
gcaggccgggagcgcggtgccacgctgttcaccacgctcgtcgccgccgcccaggtctac
ctggcccggctctccggcgggcaggacatcgccgtcggtaccgtcaccgccggccgcgac
ctgcccgagacgcagaatctggtcgggttcttcgtcaacaccctggtgctgcgctccgag
gtgcggcccgagcagaccttcccggagttcgtcaccgccgtccggcagacggtgcgcgac
gccttcgcccaccaggacgtgcccttcgagcgggtggtggacgaggtgcagccggtgcgc
gacaccagccgcaccccgctgttccaggtgatggtcgtcctgcagaacacgccctccgcc
gagctggacctgcccggtctggaggtcaccgacgtcgagacggagctgcggcacgcggcc
ttcgacctcaccctggagttcgccgagacggagaccggcgcgctgcacggcctgctcacc
tacaacaccggcctgttcgacccggcgaccgccgagcgcatggccgaacagctcggcacc
ctgctgaccgccctcgccgaggacccggaccggccggtgggcacgctgccgctcaccacc
gacgccgagctcaaggccctgctcgaccaggggcacggcaccgcccgcccggtcccggcg
gccacgctgccccggctgttcgaacggcaggcggcccgcaccccggacgcgatcgccctg
gccgacggcgcccggcagtggacgtacgcgcaggcggaccgcgccgccaaccggctcgcc
caccggctcatcgcccgcggtgccggccccgagaccgtcgtggccctggcgctgccccgg
ggcgcggccgcggtcgtcgcccagctcgccgtcaccaaggccggcggcgccttcctcccc
gtcgaccccgactaccccgagcagcggcgccggttcatgatccgcgacgcgggcgccgcg
ctggtcctggacgaccccgaggaggtgtgggccgccgggggaccggacaccgcccccacc
gacgcggaccgcaccgccccgctcaccccgcaccaccccgcctacgtcatctacacctcc
ggctccaccggcacccccaagggcgtcgtcgtcacccacagcggactggccgcgttcgcc
gcggccgccgccgagcgctacgccgccggacccggcgaccgggtgctgcagttcgcctcg
cccagcttcgacgcctccgtcctggaactgtgcgtctccctgctcaccggcgccaccctg
gtcaccggcgaggagggcccgctggtcggcgaacggctggcgcaggtgctcgccgagcgg
cggatcagccacacgctgatccccccggccgccctcgccaccgtcccggccgagtgggcc
acggccctgccggagctgcgcaccctgatcgtcggcgccgaggcgtgccccgccgatctg
gtcgagcggtgggcgcccggccgccggatgatcaactcgtacgggcccacggaggccacc
gtggtcgccacctggaccggcccgctcgcccccggggcgggcgccccgccgatcggccgc
ccggccggggcggcccgcgtctacgtcctcgacgccgcgctgcgtccggtaccgcccggc
gtgctgggcgagctgtacgtggcgggcccgggcctggcccggggctacctcgaccggccc
ggcctgaccgcctcccggttcgtgcccgacccgttcggggcgccgggggagcggatgtac
cgcaccggggacctggtgcgctgggacgccgacggacagctccgtttcgccggccgcgcc
gacgcccaggtcaaactccgcggcttccgcatcgagccgggggagatcgaggccgccctg
cgccggaccgcccgggtgcgcgacgcggtggtcgtggtgcgcgacgacgagaccaccggg
acggcgcggctggtcgcgtacgtcgtccccgccaccggagacgacggacaccccggcgcc
cggccgcacgacgggcggaccggaccgggcgaggagcaggccgcaccgggcgaggagccg
gccgggccgcgggaggaactggccgggctgcgggaagagctggccgggcacctgcccccg
cacatggtcccgtcggtgttcgtcccgctccggcggctgccgctcaccccgaacggcaaa
ctggaccggagcgccctgcccgcccccggccccgccgccgcgcacggcggaccgcgcacc
gccccgcgcacggacaccgaacggcgcgtcgcccgcgtctgggccgacgtcctcggcgtg
ccggaggtcggcgccgacgacaacttcttccacctgggcggcgactccatcctcagcctc
caggtggtgtcccggctgcgccgcgaggggttgcacatcgccacgcgcgacctgttcacc
caccagaccgtcgccgaactggccgccgtggtccgcaccgggccgcagcgctccggtgac
ggcccggtcagcggcgacgtcccgctcacccccatccaggagtggttcctgaccaccccg
cgcgccgcgcaccaccacttcaaccagtcgctgctgctggaactggagggcacacccgac
ccggcggcactggagacggccctcgccgccctgctcacccaccacgacgcgctgcgcatg
cgcttcacccgggacgccgacggctggcaccagttcaacccgccgccggccgaggaccgg
gacgtcctcgtccgccacgacctgaccggactcgcccccgacgaggccgacgccgccatg
gagcgggccgccgacgaactccacgccggcttcgccctggaagacggccccctgctgcgg
gccgggctgttcacgggcggccccggccgccccgccttcctcctcctggtcgcccaccac
ctcgtcgtggacgccgtgtcctggcggatcctgcgcgacgacctggaggccgcctaccgg
caggcggtgcggggcgagccggtcgtactgggggagcgcaccacctcctaccgggactgg
gcccgcggactcgccgcccatgtggccggcggctccctggaccacgaactgccttactgg
gaggaggcggtggccgccgaaccggtgccgggcccggccctccccgacgcgggcgagtcc
cgtgcgctcaccgtcgagctcggcgaggaggacaccgaagccctgctgcggtccgccccc
accgcctaccgcacccgcgtcaacgacgtcctgctcgccgccctcgccctcgccctcgcc
cgctggaccggcggggaacgggtccgcctggacctggagggccacggccgcgaggacctg
ctcgacggggtcgacctgtcccgcaccgtcggctggttcaccaccgtccacccggtcgcg
ctgcgcgtcgacgcgccggacgacctcggcccggcccgcgactggcgcgccctggtcaag
tcggtgcgccgccagctccgcgccgtgcccggcaacggcatcggcttcggtgccctgcgc
acctacggcccgcccgaggtgcgcgagcggctcggcggcgcggcctcccacggccaggtg
gtgttcaactacctcggccagtgggacgcccgcccggccggcgacgacgccccgggcacc
ggtctcatccgcgccgagcacggcagcctcggccgggaccacgacccccgggacggcgga
tcccacctgctggaggtggtcggggcggtgcagcacggccgtctcgccttcacctggcac
caccgcccggccgtccacgacacggcgacggtgcggcgcgtcgccggggagttcgccgag
gcgctgcggcacatcgcgcggcacgcacggggggtgcgctga

DBGET integrated database retrieval system