KEGG   Streptomyces cyaneogriseus: TU94_31420Help
Entry
TU94_31420        CDS       T03687                                 

Definition
(GenBank) beta-galactosidase
  KO
K01190  beta-galactosidase [EC:3.2.1.23]
Organism
scw  Streptomyces cyaneogriseus
Pathway
scw00052  Galactose metabolism
scw00511  Other glycan degradation
scw00600  Sphingolipid metabolism
scw01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:scw00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    TU94_31420
  Lipid metabolism
   00600 Sphingolipid metabolism
    TU94_31420
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    TU94_31420
Enzymes [BR:scw01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     TU94_31420
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_2_C DUF4982 Glyco_hydro_2_N Glyco_hydro_2 F5_F8_type_C Cellulase
Motif
Other DBs
NCBI-ProteinID: AJP05266
UniProt: A0A0C5GL68
LinkDB All DBs
Position
7503786..7506887
Genome map
AA seq 1033 aa AA seqDB search
MTVTRRSVLAASAAAPAAGALLGTPAARAADVTGDAPGRRIVALRDGWRFALVNPGGITD
PTGQYAQAADPEYDDAAWRRVAVPHDWSIEQTPTTGHGTTSGTGFLPGGLGWYRLAFTLP
PAYAGKRISVEFDGVYMDAYVYCNGREIGRHPYGYTGFALDLTEVAHTDGRTPNVLAVKV
QNRLPSSRWYSGSGIYREARLVVTEPVHVARWGTYVTTPQVTDDRALVRARTTVVNTTGA
SRQVEMRSVVRDADGRTVARAVSTAPVAPAGEHTGTHELTVPRPRLWDFATPHRYTLRTE
LRVGGRSVDAYDTPFGIRTFHIDPEEGFHLNGVHTKIKGVDLHHDLGALGAAVSIDAIRR
QMDIMKSMGVNALRTSHNPPAPELVRVCEELGIVMLVEAFDCWRTGKNPYDYGRFFDEWC
ERDATEMVHAARNSPAVVMWSIGNEVPDSTTTAGLAMADRIIDAIRAADDTRPLVIGSDK
YRHLPAKGSPADLMLAKLDGLGLNYNTAKSVDALHQAYPHLFLFESESSSETSTRGTYQE
PERLNTGENHTPGRRATSSYDNNLASWTMSGEYGHKKDRDRKWFAGQFLWSGIDYIGEPT
PYDVFPVKASFFGAVDTAGFPKDMYHLFRSQWTDEPMVHLLPMTWNHEEGDTVEVWAYAN
VATVELFLNGRSLGTRSFDTKTTVDGRAYLETTEATGDDKTFTDGPYPGSYTSPNGSAGK
LHLTWKVPFEPGELRAVARRDGEVVATDVLRTAGAPHAIRLTPDRASAAADGRSLVFVTA
EVVDRHGVVVPDAGHLLSFEVTGGSLAGLDNGRQESAERYQASTRTAFHGKALAIVRAGT
RAGTLRVTARADGLRTGTAAVRTTRAASRATTPAPGFAPDHPAPRTYPYADAGYSGRPGT
LPAAMLDGDPATGWSNGFLKAATPLLPAFDGARAEDWVSVDYGRTRAFDRLEVSFTVDGE
HSLPAAAEAAVFDGRGWRAVEGARVEWATASDTPTVITFDRVRGSRLRLTLTSRHPGRPQ
GAVRISRWEAPAA
NT seq 3102 nt NT seq  +upstreamnt  +downstreamnt
atgacagtcacgcgcagatcggtcctcgccgcctccgcggccgccccggcggccggagcg
ctcctgggcaccccggcggcccgggccgcggacgtgacgggcgacgcccccggccgccgg
atcgtcgccctgcgcgacggctggcgtttcgcgctggtgaacccgggcgggatcaccgac
ccgacggggcagtacgcgcaggccgcggacccggagtacgacgacgcggcgtggcggcgg
gtggccgtgccgcacgactggagcatcgagcagacgcccacgaccgggcacggcacgacc
agtggcaccggattcctccccggcggcctcggctggtaccgcctggccttcaccctgccg
cccgcgtacgccggcaagcggatctcggtcgagttcgacggggtctacatggacgcgtac
gtgtactgcaacggccgggagatcggccggcatccctacggctatacgggcttcgccctc
gacctcaccgaggtggcgcacaccgacggccgcacgcccaacgtcctcgcggtcaaggtg
cagaaccggctgcccagcagccgctggtactccggcagcggcatctaccgcgaggcccgc
ctggtcgtcaccgagccggtgcacgtggcgcgctggggaacatatgtgacgactcctcag
gtgacggacgaccgggccctggtgcgggcccgcaccaccgtcgtgaacacgacgggggcc
tcccggcaggtcgagatgcggtcggtcgtccgggacgcggacgggcgcacggtggcccgc
gccgtctccacggccccggtcgcaccggcaggcgaacacaccgggacccatgaactgacc
gtcccccgcccccgtctgtgggacttcgccaccccgcaccgctacaccctcaggaccgaa
ctgcgcgtcggcggccgcagcgtcgacgcctacgacacccccttcggcatccgcaccttc
cacatcgaccccgaggagggcttccacctcaacggcgtccacaccaagatcaagggggtc
gacctccaccacgacctgggcgcgctgggcgccgccgtcagcatcgacgcgatccgccgg
cagatggacatcatgaagtccatgggcgtcaacgccctgcgcacctcgcacaatccgccc
gcgcccgaactggtccgtgtctgcgaggaactgggcatcgtcatgctggtggaggcgttc
gactgctggcggaccggcaagaacccgtacgactacggccggttcttcgacgagtggtgc
gagagggacgccaccgagatggtgcacgcggcccgcaactcgcccgccgtggtgatgtgg
tccatcggcaacgaggtccccgactccaccaccaccgccgggctcgccatggccgaccgg
atcatcgacgcgatccgggccgccgacgacacccgtcccctcgtcatcggctccgacaag
taccgccacctgcccgccaagggctcgcccgccgacctgatgctggccaagctggacggc
ctcggcctcaactacaacaccgccaagtcggtggacgccctgcaccaggcgtatccccat
ctgttcctcttcgagtcggagtcctcctcggagacctccacccgcggcacctaccaggag
ccggagcgtctcaacaccggtgagaaccacacgccgggcaggcgcgcgacctcctcctac
gacaacaacctcgcctcctggaccatgagcggcgagtacggccacaagaaggaccgcgac
cgcaagtggttcgccgggcagttcctgtggtcgggcatcgactacatcggggagcccacg
ccgtacgacgtcttcccggtgaaggcatccttcttcggcgcggtcgacaccgccggattc
cccaaggacatgtaccacctcttccgcagccagtggaccgacgagccgatggtccacctg
ctgcccatgacctggaaccacgaggagggcgacacggtcgaggtgtgggcgtacgcgaac
gtcgccaccgtggagctcttcctcaacggcaggtccctcggtacgcggagcttcgacacc
aagacgaccgtcgacggccgcgcctacctggagaccaccgaggcgaccggcgacgacaag
accttcaccgacggcccctacccggggagctacaccagccccaacggcagcgcgggcaaa
ctccatctgacctggaaagtgcccttcgaaccgggcgagctcagggccgtggcccggcgg
gacggcgaggtggttgccaccgatgtcctgcgcaccgccggggcaccgcacgcgatacgg
ctgacgccggaccgcgcctcggccgccgcagacggccgctccctggtgttcgtgaccgcc
gaggtggtcgaccggcacggcgtggtggtgcccgacgccgggcacctgctctccttcgag
gtcaccggtggatccctggccggactcgacaacggccgccaggagagcgccgagcgctac
caggcgagcacccgcaccgccttccacggcaaggccctggccatcgtccgcgccggcacc
cgggccgggacgctccgggtgaccgcccgggccgacgggctgcgcaccggcacggccgcc
gtgcggaccacccgggcggcctcccgcgcgaccacgcccgcgcccggcttcgcgccggac
catcccgcgccccggacgtacccgtacgcggacgccggttactccggccgccccggcacc
ctgcccgccgccatgctcgacggcgacccggccaccggctggtccaacggcttcctcaag
gcggccacccccctgctgcccgccttcgacggggcccgcgccgaggactgggtctcggtc
gactacgggcggacgcgggccttcgaccgcctggaggtctccttcaccgtcgacggggag
cacagtctgccggccgcggccgaggccgccgtcttcgacggccgcggatggcgggcggtc
gagggcgcccgcgtcgagtgggccaccgcctccgacacgcccaccgtcatcaccttcgac
cgggtccggggttcccggctgcgtctgacgctgacgagccgtcacccgggccggccgcag
ggggccgtgcgtatcagccggtgggaggcgcccgccgcgtga

DBGET integrated database retrieval system