KEGG   Streptomyces sp. CdTB01: AS200_08195Help
Entry
AS200_08195       CDS       T04240                                 

Definition
(GenBank) isocitrate dehydrogenase
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
scx  Streptomyces sp. CdTB01
Pathway
scx00020  Citrate cycle (TCA cycle)
scx00480  Glutathione metabolism
scx01100  Metabolic pathways
scx01110  Biosynthesis of secondary metabolites
scx01120  Microbial metabolism in diverse environments
scx01130  Biosynthesis of antibiotics
scx01200  Carbon metabolism
scx01210  2-Oxocarboxylic acid metabolism
scx01230  Biosynthesis of amino acids
Module
scx_M00009  Citrate cycle (TCA cycle, Krebs cycle)
scx_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:scx00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    AS200_08195
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    AS200_08195
Enzymes [BR:scx01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     AS200_08195
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IDH
Motif
Other DBs
NCBI-ProteinID: ALV32018
UniProt: A0A0U3PH16
LinkDB All DBs
Position
1869597..1871816
Genome map
AA seq 739 aa AA seqDB search
MTDSTIIYTHTDEAPALATYSFLPVVQAYASQAGVSVETRDISLAGRIIAVFPEYLTEDQ
RIPDALHELGELAKTPAANIIKLPNISASIPQLKAAVAELQAQGYALPNYPDDPKTDEER
DIQARYDKVKGSAVNPVLREGNSDRRAPASVKNYAKNHPHRMGAWTSESKTNVATMGEND
FRSTEKSAVISEAGALRIELVGDDGSTTVLRESVPVLEGEVVDASVMRVAALREFLTAQV
AEAKAQGVLFSVHLKATMMKVSDPIIFGHVVRAFFPKTFAKYGETLAAAGLTPNDGLGGI
YKGLEGLPEGAEIKASFDAELAEGPALAMVDSDKGITNLHVPSDVIVDASMPAMIRTSGH
MWGPDGQEADTLAVLPDSSYAGVYQAVIEDCRANGAYDPSTMGSVPNVGLMAQKAEEYGS
HDKTFEIPVTGTVRLVDQAGNVVIEQTVSAGDIFRACQTKDAPIKDWVKLAVTRARATGD
PAVFWLDETRAHDANLIAKVNTYLAEHDTEGLDIRVLNPVEATKFSVERIRRGENTISVT
GNVLRDYLTDLFPILELGTSAKMLSVVPLMAGGGLFETGAGGSAPKHVQQLVKENYLRWD
SLGEFFALVPSLEQYASATDNPKAKVLADTLDRATATFLNEDKSPTRRVGGIDNRGSHFY
LSLYWAQELARQTEDADLAKAFAPLAETLAANEQKIVEELNAVQGRPADIGGYYQPDPAK
AAAVMRPSATWNEALASLS
NT seq 2220 nt NT seq  +upstreamnt  +downstreamnt
gtgactgactcgaccatcatctatacgcacactgacgaggccccggccctggcgacgtat
tccttcctgccggtggtccaggcgtacgcctcgcaggcgggtgtctccgtggagacgcgg
gacatctcactggcgggccgcatcatcgcggtgttcccggagtacctgaccgaggaccag
cgcatcccggacgccctgcacgagctgggtgagctggccaagacgcccgcggccaacatc
atcaagctgccgaacatctcggcgtcgatcccgcagctcaaggccgccgtcgccgagctg
caggcgcagggctacgcgctgccgaactacccggacgaccccaagaccgacgaggagcgg
gacatccaggcccgctacgacaaggtcaagggctccgccgtgaacccggtcctgcgtgag
ggcaactccgaccgccgcgcccccgcctcggtcaagaactacgccaagaaccacccgcac
cgcatgggcgcctggacctccgagtccaagacgaacgtcgcgaccatgggcgagaacgac
ttccgctccaccgagaagtccgccgtcatctccgaggccggcgcgctgcgcatcgagctg
gtcggcgacgacggctccacgaccgtgctgcgcgagtccgtcccggtcctcgagggcgag
gtcgtcgacgcctccgtgatgcgcgtcgccgcgctgcgcgagttcctgacggcgcaggtc
gccgaggccaaggcgcagggtgtgctgttctccgtgcacctgaaggccacgatgatgaag
gtctccgacccgatcatcttcggtcacgtggtgcgcgcgttcttcccgaagacgttcgcg
aagtacggcgagacgctcgccgcggccggcctgaccccgaacgacggtctgggcggcatc
tacaagggcctggagggtctgcccgagggcgccgagatcaaggcctccttcgacgccgag
ctcgccgagggcccggcgctggcgatggtcgactccgacaagggcatcaccaacctgcac
gtgccgtccgacgtcatcgtcgacgcctcgatgccggccatgatccgcacctccggccac
atgtggggcccggacggccaggaggccgacacgctcgccgtcctgccggactcctcctac
gcgggcgtctaccaggccgtgatcgaggactgccgggccaacggcgcctacgacccctcc
accatgggctcggtcccgaacgtcggcctgatggcgcagaaggccgaggagtacggctcc
cacgacaagaccttcgagatccccgtcaccggcaccgtccgcctcgtggaccaggccggc
aacgtggtcatcgagcagacggtctccgccggcgacatcttccgcgcctgccagaccaag
gacgcccccatcaaggactgggtgaagctggccgtcacccgcgcccgcgccaccggcgac
ccggcggtgttctggctcgacgagacccgcgcgcacgacgccaacctgatcgccaaggtc
aacacctacctggcggagcacgacaccgagggcctggacatccgcgtcctgaacccggtc
gaggcgacgaagttctcggtggagcgcatccgccgcggcgagaacaccatctccgtcacc
ggcaacgtgctgcgcgactacctgacggacctgttcccgatcctggagctgggcaccagc
gccaagatgctgtcggtcgtcccgctgatggcgggcggcggcctgttcgagacgggcgcc
ggcggctccgcgccgaagcacgtccagcagctggtcaaggagaactacctgcgctgggac
tccctgggcgagttcttcgcgctggtgccgtcgctggagcagtacgcgagcgccacggac
aacccgaaggccaaggtcctcgccgacacgctggaccgcgccacggcgaccttcctcaac
gaggacaagtccccgacccgtcgcgtcggcggcatcgacaaccgcggcagccacttctac
ctgtccctgtactgggcgcaggagctggcccggcagaccgaggacgcggacctggccaag
gccttcgccccgctcgccgagacgctcgccgcgaacgagcagaagatcgtcgaggagctg
aacgccgtccagggccggccggccgacatcggcggctactaccagcccgacccggccaag
gcggcggcggtcatgcgcccgtcggccacctggaacgaggcgctggcttccctcagctga

DBGET integrated database retrieval system