KEGG   Streptomyces sp. CdTB01: AS200_09240Help
Entry
AS200_09240       CDS       T04240                                 

Definition
(GenBank) ATP-dependent DNA ligase
Organism
scx  Streptomyces sp. CdTB01
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_C RNA_ligase
Motif
Other DBs
NCBI-ProteinID: ALV32203
UniProt: A0A0U3NLN3
LinkDB All DBs
Position
2090019..2091080
Genome map
AA seq 353 aa AA seqDB search
MDLPVMPPVKPMLAKSVAKIPPGMQYEAKWDGFRAIVFRDGAEVELGSRTGKPLTRYFPE
LVSALRERVPERCVLDGEIVIARDGHLDFDALTERIHPADSRVRTLAERTPSSFVAFDLL
ALADESLLDVPLTDRRALLERALSGVTAPVHLAPATTDLEVAQGWFEQYEGAGLDGVIAK
PLTVRYLQDERAMFKIKHERTADVVVAGYRLHKSGPVVGSLLLGLYDDQGRLQHVGVSAA
FPMKRRAELIEELEPLRMADVAGHPWAAWSDEAAHETARLPGAPSRWSGKKDLSWVPLSP
ERVAEVAYDHMENGARFRHTARFRRWRPDRTPDSCTYAQLEEPVRYDLGEILG
NT seq 1062 nt NT seq  +upstreamnt  +downstreamnt
atggatctcccggtgatgccgcccgtgaagccgatgctcgccaagtcggtggcgaagatc
ccgccgggcatgcagtacgaggcgaagtgggacggcttccgggccatcgtgttccgcgac
ggggccgaggtcgagctcggcagccgtacgggcaagccgctgaccaggtacttccccgag
ctggtgagcgcgctcagggagcgggtgcccgagcggtgcgtcctcgacggggagatcgtg
atcgcccgcgacgggcacctcgacttcgacgcgctcaccgagcgcatccacccggcggac
tcacgcgtgcggacgctcgccgagcggaccccgtcctccttcgtggccttcgacctgctg
gccctggcggacgagtcgctgctggacgtcccgctcaccgaccgccgggcgctgctggaa
cgggcgctgtccggggtcaccgcgccggtgcacctggcgccggcgacgaccgacctggag
gtggcgcagggctggttcgagcagtacgagggggccggcctggacggtgtcatcgccaag
ccgctcacggtgcgctacctccaggacgagcgcgccatgttcaagattaagcacgagcgg
acggcggacgtcgtcgtcgcgggctaccgcctgcacaagagcggacccgtcgtgggctcg
ctgctgctcggcctctacgacgaccagggccggctgcagcatgtcggcgtgtccgccgcc
ttcccgatgaagcggcgcgcggagctgatcgaggagctggagccgctgaggatggcggat
gtcgcggggcacccctgggcggcctggtccgacgaggcggcgcacgagacggcgcggctg
cccggcgcgccgagccgctggtcgggcaagaaggacctgtcgtgggtgccgctcagcccg
gagcgggtggccgaggtggcgtacgaccacatggagaacggcgcgcgcttccggcacacg
gcccgcttccgccgctggcgcccggaccggacccccgacagctgcacctacgcgcaactg
gaggagccggtccgctacgacctgggcgagatcctcggctag

DBGET integrated database retrieval system