KEGG   Streptomyces sp. CdTB01: AS200_11030Help
Entry
AS200_11030       CDS       T04240                                 

Definition
(GenBank) aminotransferase class III
  KO
K00823  4-aminobutyrate aminotransferase [EC:2.6.1.19]
Organism
scx  Streptomyces sp. CdTB01
Pathway
scx00250  Alanine, aspartate and glutamate metabolism
scx00410  beta-Alanine metabolism
scx00640  Propanoate metabolism
scx00650  Butanoate metabolism
scx01100  Metabolic pathways
scx01120  Microbial metabolism in diverse environments
Module
scx_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:scx00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    AS200_11030
   00650 Butanoate metabolism
    AS200_11030
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    AS200_11030
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    AS200_11030
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:scx01007]
    AS200_11030
Enzymes [BR:scx01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     AS200_11030
Amino acid related enzymes [BR:scx01007]
 Aminotransferase (transaminase)
  Class III
   AS200_11030
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Beta_elim_lyase Aminotran_1_2
Motif
Other DBs
NCBI-ProteinID: ALV32520
UniProt: A0A0U3NIB8
LinkDB All DBs
Position
complement(2502284..2503567)
Genome map
AA seq 427 aa AA seqDB search
MSDLYARHRSVLPDWLALYYGDPIEITHGEGRHVWDSDGNKYLDFFGGILTTMTAHALPE
VTKAVSEQAGRILHSSTLYLNRPMVELAERIAQLSGIPDARVFFTTSGTEANDTALLLAT
TYRRSNTILAMRNSYHGRSFSAVGITGNRGWSPTSLSPLQTLYVHGGVRTRCPYASLRDA
DFIAACVEDLKDLLGHTRPPAALIAEPIQGVGGFTSGPDGLYAAFREVLAERGILWIADE
VQTGWGRTGDHFWGWQAHGQNGPPDILTFAKGIGNGSSIGGVVARAEIMNCLDANSISTF
GGTQITMAAGLANLAYLLEHDLQGNARRVGGLLAERLRAVAAQVPHVREVRGRGLMLGVE
LVRPGTDQADPDAAAAVLEATRAGGLLIGKGGGHNTSALRIAPPLTLTVAEAEEGAAILE
TALRSLS
NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt
gtgagcgacctctacgcacgccatcgttccgttctgccggactggctcgccctctactac
ggcgacccgatcgagatcacccacggcgagggccgccacgtctgggactcggacggcaac
aagtacctcgacttcttcggcggcatcctcaccacgatgaccgcgcacgcgctgcccgag
gtgacgaaggcggtgagcgagcaggcggggcggatcctgcactcgtcgaccctctacctc
aaccgccccatggtcgaactcgccgagcgcatcgcccagttgagcggcatcccggacgcc
cgtgtcttcttcaccacctcggggaccgaggccaacgacaccgcgctgctgctcgccacg
acctaccggcgcagcaacacgatcctggcgatgcgcaacagctaccacggccgctccttc
agcgccgtcggcatcaccggcaaccgcggctggtcgccgacctcgctgtccccgctgcag
acgctctacgtccacggcggtgtccgcacccgctgcccgtacgcctccctgagagacgcc
gacttcatcgcggcctgcgtcgaggacctcaaggacctgctcgggcacacccgcccgccc
gcggccctgatcgccgaaccgatccagggcgtcggcggcttcacctcgggcccggacggc
ctgtacgcggccttccgcgaggtcctcgccgagcgcggcatcctgtggatcgccgacgag
gtgcagaccggctggggccgcaccggcgaccacttctggggctggcaggcacacgggcag
aacggtccgccggacatcctgaccttcgccaagggaatcggcaacggcagctccatcggc
ggtgtcgtcgcccgcgccgagatcatgaactgcctggacgccaacagcatctcgacgttc
ggcggcacccagatcaccatggcggcgggcctggccaacctcgcctacctcctggagcac
gacctgcagggcaacgcccggcgcgtcggtggactgctcgccgagcggctgcgggccgtc
gccgcacaggtcccgcacgtacgggaggtgcgcgggcgcggactgatgctcggcgtcgaa
ctggtcaggcccggcaccgaccaggccgatccggacgcggcggccgccgtgctggaggcg
acccgcgcgggcggcctgctgatcggcaagggcggcggccacaacaccagcgccctgcgc
atcgccccgccgctgaccctgaccgtcgcggaggccgaggaaggcgccgcgatcctcgaa
accgctctgaggagcctgtcgtaa

DBGET integrated database retrieval system