KEGG   Streptomyces sp. CdTB01: AS200_17315Help
Entry
AS200_17315       CDS       T04240                                 

Gene name
kgd
Definition
(GenBank) alpha-ketoglutarate decarboxylase
  KO
K00164  2-oxoglutarate dehydrogenase E1 component [EC:1.2.4.2]
Organism
scx  Streptomyces sp. CdTB01
Pathway
scx00020  Citrate cycle (TCA cycle)
scx00310  Lysine degradation
scx00380  Tryptophan metabolism
scx01100  Metabolic pathways
scx01110  Biosynthesis of secondary metabolites
scx01120  Microbial metabolism in diverse environments
scx01130  Biosynthesis of antibiotics
scx01200  Carbon metabolism
Module
scx_M00009  Citrate cycle (TCA cycle, Krebs cycle)
scx_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:scx00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    AS200_17315 (kgd)
  Amino acid metabolism
   00310 Lysine degradation
    AS200_17315 (kgd)
   00380 Tryptophan metabolism
    AS200_17315 (kgd)
Enzymes [BR:scx01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.4  With a disulfide as acceptor
    1.2.4.2  oxoglutarate dehydrogenase (succinyl-transferring)
     AS200_17315 (kgd)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: E1_dh Transket_pyr 2-oxoacid_dh OxoGdeHyase_C 2-oxogl_dehyd_N
Motif
Other DBs
NCBI-ProteinID: ALV33600
UniProt: A0A0U3NVA0
LinkDB All DBs
Position
3928147..3931947
Genome map
AA seq 1266 aa AA seqDB search
MSPQSPSNSSISTDDQAGKNPAAAFGPNEWLVDEIYQQYLQDPNSVDRAWWDFFADYKPG
AAASAPAAAESTTAAPAAPAAAPAAPAAASVPAPAQAAPAQPRPAAAAPAPAAKPAAAAP
APAAAKPAAAKPAAKAEPAAQAPDGPELVTLRGPAAAVVKNMNASLELPTATSVRAVPVK
LLFDNRIVINNHLKRARGGKISFTHLIGYAMVQAIKAMPSMNHAFGEKDGKPTLIKPAHV
NLGLAIDLVKPNGDRQLVVAAIKKAETLNFFEFWQAYEDIVRRARDGKLTMDDFTGVTVS
LTNPGGLGTVHSVPRLMPGQSVIMGVGSMDYPAEFQGTSQDTLNKLGISKVMTLTSTYDH
RVIQGAASGEFLRQVANLLLGENGFYDEIFEALRIPYEPVRWLKDIDASHDDDVTKAARV
FELIHSYRVRGHVMADTDPLEYRQRKHPDLDITEHGLTLWDLEREFAVGGFAGKSMMKLR
DILGVLRDSYCRTTGIEFMHIQDPKQRKWIQDRVERAHAKPEREEQLRILRRLNAAEAFE
TFLQTKYVGQKRFSLEGGESVIPLLDAVLDSAAESRLDEVVIGMAHRGRLNVLANIVGKS
YAQIFREFEGNLDPKSMHGSGDVKYHLGAQGTFTGLDGEQIKVSLAANPSHLETVDPVIE
GIVRAKQDIINKGGTDFTVLPIALHGDAAFAGQGVVAETLNMSQLRGYRTGGTVHIVINN
QVGFTAAPESSRSSMYATDVARMIEAPIFHVNGDDPEAVVRVARLAFEFRQAFNKDVVID
LICYRRRGHNESDNPAFTQPLMYDLIDKKRSVRKLYTESLIGRGDITLEEAEQALQDYQG
QLEKVFTEVREAITAQPASGPVSDPQAEFPVAVNTAISTETVKRIAESQVNIPDTFHVHP
RLLPQLQRRASMVEDGTIDWGMGETLAVGSLLLEGTPVRLSGQDSQRGTFGQRHAVLIDR
ETGEEYTPLQYLAEEQARYNVYNSLLSEYAVMGFEYGYSLARPDALVMWEAQFGDFVNGA
QTVVDEYISAAEQKWGQTSGVTLLLPHGYEGQGPDHSSARVERFLQLCAQNNMTVAMPTL
PSNYFHLLRWQVHNPHHKPLVVFTPKSMLRLKAAASKTEEFTSGQFRPVIGDTSVDAAAV
RKVVFVAGKLYYDLEAERQKRGITDTAIIRIERLYPLPGAELQAEIAKYPNAEKYLWAQE
EPANQGAWPFIALNLIDHLDLAVGADVPHGERLRRISRPHSSSPAVGSAKRHQAEQEQLV
REVFEA
NT seq 3801 nt NT seq  +upstreamnt  +downstreamnt
gtgtcgccacagtcccccagtaactcgagcatctcgaccgacgaccaagccgggaagaac
cccgctgctgcgttcggtcccaacgagtggctcgtcgacgagatctatcagcagtacctc
caggacccgaactcggtagaccgagcctggtgggacttcttcgccgactacaagccggga
gccgccgcctcggcgccggctgccgcggagagcaccacagcggcccccgcggcgcccgcc
gcggctccggcggcccctgccgccgcctccgtacccgcgccggcccaggccgcccccgcg
cagccccggcccgctgccgccgccccggccccggcagccaagccggccgccgccgcaccg
gcgcccgccgcggccaagcccgccgccgccaagccggcggcgaaggccgagcccgccgca
caggcccccgacggcccggagctggtgacgctgcgcggtcccgccgccgccgtcgtgaag
aacatgaacgcctccctggagctgccgaccgccacctcggtccgcgcggtcccggtgaag
ctgctgttcgacaaccgcatcgtcatcaacaaccacctcaagcgggcccggggcgggaag
atctccttcacgcacctgatcggctacgcgatggtgcaggccatcaaggccatgccgtcg
atgaaccacgcgttcggcgagaaggacggcaagccgacgctgatcaagccggcgcacgtc
aacctgggcctcgccatcgacctggtgaagcccaacggcgaccgccagctcgtcgtcgcg
gccatcaagaaggccgagacgctgaacttcttcgagttctggcaggcctacgaggacatc
gtccgccgcgcccgcgacggcaagctgacgatggacgacttcaccggcgtcacggtctcc
ctgaccaaccccggcggcctgggcaccgtgcactccgtgccgcggctgatgcccggccag
tcggtgatcatgggcgtcggctccatggactacccggcggagttccagggcaccagccag
gacaccctgaacaagctcggtatctcgaaggtcatgacgctcacgtcgacctacgaccac
cgggtgatccagggcgccgcctcgggcgagttcctgcgccaggtcgccaacctcctgctc
ggcgagaacggcttctacgacgagatcttcgaggcgctgcgcatcccctacgagccggtc
cgctggctcaaggacatcgacgccagccacgacgacgacgtcaccaaggccgcccgcgtc
ttcgagctgatccactcctaccgggtccgcggccacgtcatggccgacaccgacccgctg
gagtaccgccagcgcaagcaccccgacctggacatcaccgagcacggcctcaccctgtgg
gacctggagcgcgagttcgccgtcggcggcttcgccggcaagtcgatgatgaagctgcgc
gacatcctcggcgtgctgcgcgactcgtactgccgcaccaccggcatcgagttcatgcac
atccaggaccccaagcagcgcaagtggatccaggaccgcgtcgagcgcgcgcacgccaag
ccggagcgcgaggagcagctgcgcatcctgcgccggctgaacgcggcggaggccttcgag
accttcctgcagacgaagtacgtcggccagaagcgcttctccctcgagggcggcgagtcg
gtcatcccgctgctggacgcggtcctcgactcggccgccgagtcccgcctggacgaggtc
gtcatcggcatggcccaccgcggccggctgaacgtcctggcgaacatcgtcggcaagtcg
tacgcgcagatcttccgcgagttcgagggcaacctcgacccgaagtccatgcacggctcc
ggcgacgtgaagtaccacctgggcgcccagggcaccttcaccggcctggacggcgagcag
atcaaggtctcgctggccgcgaacccctcccacctggagacggtcgacccggtcatcgag
ggcatcgtccgcgccaagcaggacatcatcaacaagggcggcacggacttcaccgtcctg
ccgatcgcgctgcacggcgacgcggccttcgcgggccagggcgtggtggccgagaccctg
aacatgtcgcagctgcgcggctaccgcaccggcggcacggtccacatcgtcatcaacaac
caggtcggcttcaccgcggcccccgagtcctcgcgctcctccatgtacgccacggacgtg
gcccgcatgatcgaggccccgatcttccacgtgaacggcgacgacccggaggccgtggtc
cgcgtcgcgcggctggccttcgagttccgccaggcgttcaacaaggacgtggtgatcgac
ctcatctgctaccgccgccgcggtcacaacgagtcggacaacccggccttcacccagccg
ctgatgtacgacctgatcgacaagaagcgctcggtgcgcaagctgtacaccgagtccctg
atcggtcgcggcgacatcaccctggaagaggccgagcaggccctgcaggactaccagggc
cagctggagaaggtcttcaccgaggtccgcgaggccatcaccgcccagcccgcctcgggc
ccggtgtcggacccgcaggcggagttcccggtggccgtgaacaccgcgatctccaccgag
accgtgaagcggatcgccgagtcccaggtcaacatcccggacaccttccacgtgcacccg
cgcctgctgccgcagctgcagcgccgggcgtcgatggtcgaggacggcacgatcgactgg
ggcatgggcgagaccctcgccgtcggctccctgctgctggagggcaccccggtgcgcctg
tccggccaggactcccagcgcggcaccttcggccagcgccacgcggtcctcatcgaccgc
gagacgggcgaggagtacaccccgctgcagtacctcgccgaggagcaggcccgctacaac
gtctacaactccctgctctccgagtacgcggtcatgggcttcgagtacggctactcgctc
gcccgtcccgacgcgctcgtgatgtgggaggcgcagttcggcgacttcgtcaacggcgcg
cagacggtggtcgacgagtacatctcggcggccgagcagaagtggggccagacctccggc
gtcaccctgctcctcccgcacggctacgagggccagggcccggaccactcctcggcccgc
gtcgagcgcttcctccagctgtgcgcgcagaacaacatgacggtggccatgcccacgctc
ccgtcgaactacttccacctcctgcggtggcaggtgcacaacccgcaccacaagccgctg
gtggtcttcaccccgaagtcgatgctgcgcctgaaggccgccgcgtcgaagacggaggag
ttcacctcgggtcagttccgcccggtcatcggcgacacctcggtcgacgcggccgcggtc
cgcaaggtcgtgttcgtcgcgggcaagctgtactacgacctggaggccgagcggcagaag
cgcggcatcacggacaccgcgatcatccgcatcgagcgcctgtacccgctgccgggtgcc
gagctccaggcggagatcgccaagtacccgaacgccgagaagtacctgtgggcccaggag
gagccggcgaaccagggtgcctggccgttcatcgcgctcaacctgatcgaccacctggac
ctggcggtcggcgcggacgtcccgcacggcgagcgcctgcggcgcatctcgcgcccgcac
tcctcgtccccggcggtgggctccgcgaagcgccaccaggcggagcaggagcagctggtg
cgggaggtgttcgaggcgtga

DBGET integrated database retrieval system