KEGG   Streptomyces sp. CdTB01: AS200_17430Help
Entry
AS200_17430       CDS       T04240                                 

Definition
(GenBank) superoxide dismutase
  KO
K00518  nickel superoxide dismutase [EC:1.15.1.1]
Organism
scx  Streptomyces sp. CdTB01
Brite
KEGG Orthology (KO) [BR:scx00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    AS200_17430
Enzymes [BR:scx01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     AS200_17430
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Ni
Motif
Other DBs
NCBI-ProteinID: ALV33619
UniProt: A0A0U3PXS0
LinkDB All DBs
Position
3957831..3958226
Genome map
AA seq 131 aa AA seqDB search
MLSRLFAPKVKVSAHCDLPCGVYDPAQARIEAESVKAVQEKMAGNDDPHFQARATVIKEQ
RAELAKHHVSVLWSDYFKPPHFEKYPELHQLVNDTLKALSAAKASTDPATGQKALDYIAQ
IDKIFWETKKA
NT seq 396 nt NT seq  +upstreamnt  +downstreamnt
atgctttcccgcctgtttgcccccaaggtcaaggtcagcgcgcactgcgacctgccctgc
ggcgtgtacgacccggcccaggcccgcatcgaggcggagtccgtgaaggccgtccaggag
aagatggccggcaacgacgacccgcacttccaggcgcgtgccaccgtcatcaaggagcag
cgtgccgagcttgcgaagcaccacgtctccgtgctctggagcgactacttcaagcccccg
cacttcgagaagtacccggagctgcaccagctggtcaacgacaccctgaaggccctgtcg
gccgccaaggcgtccaccgacccggccaccggccagaaggccctggactacatcgcccag
atcgacaagatcttctgggagaccaagaaggcctga

DBGET integrated database retrieval system