KEGG   Streptomyces sp. CdTB01: AS200_21845Help
Entry
AS200_21845       CDS       T04240                                 

Definition
(GenBank) glutamate decarboxylase
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
scx  Streptomyces sp. CdTB01
Pathway
scx00250  Alanine, aspartate and glutamate metabolism
scx00410  beta-Alanine metabolism
scx00430  Taurine and hypotaurine metabolism
scx00650  Butanoate metabolism
scx01100  Metabolic pathways
scx01110  Biosynthesis of secondary metabolites
scx01120  Microbial metabolism in diverse environments
scx02024  Quorum sensing
Module
scx_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:scx00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    AS200_21845
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    AS200_21845
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    AS200_21845
   00430 Taurine and hypotaurine metabolism
    AS200_21845
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    AS200_21845
Enzymes [BR:scx01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     AS200_21845
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyridoxal_deC
Motif
Other DBs
NCBI-ProteinID: ALV34405
UniProt: A0A0U3PRY0
LinkDB All DBs
Position
4887740..4889140
Genome map
AA seq 466 aa AA seqDB search
MALHKGPDQSDERALSVNPFFGEANPVGGMTEAPPRQRLPDAPMAPSSAYQLVHDELMLD
GNSRLNLATFVTTWMEPQAGVLMAECRDKNMIDKDEYPRTAELERRCVAMLADLWNAPDP
SAAVGCSTTGSSEACMLAGMALKRRWSQRRPAPGARPNLVMGVNVQVCWEKFCNFWEVEA
RQVPMEGDRFHLDAQAAAELCDENTIGVVGILGSTFDGSYEPIADLCAALDALQERTGLD
IPVHVDAASGGMIAPFLDEDLVWDFRLPRVASINTSGHKYGLVYPGVGWALWRDKEALPE
ELVFRVNYLGGDMPTFALNFSRPGAQVVAQYYTFLRLGREGYRAVQQTTRDVARSIADRV
AALGDFRLLTRGDELPVFAFTTAPEVEAYDVFDVSRRLRESGWLVPAYTFPPHREDLSVL
RIVCRNGFSADLADLFVEDLTRLLPELRRQPHPFTRDKEAATGFHH
NT seq 1401 nt NT seq  +upstreamnt  +downstreamnt
atggcgctccacaaaggtcccgaccagtccgacgagcgtgcgctgtccgtcaaccccttc
ttcggcgaggcgaatccggtcggcggcatgaccgaggccccgccccggcagcggctgccc
gacgcccccatggcgccgtcgtcggcctaccagctggtgcacgacgaactgatgctggac
ggcaactcccggctgaacctggccactttcgtcaccacctggatggagccgcaggccggc
gtcctgatggcggagtgccgggacaagaacatgatcgacaaggacgagtacccgcgcacg
gccgagctggagcggcgctgcgtggcgatgctcgccgacctgtggaacgcgccggacccg
tcggccgccgtgggctgttcgacgaccggttcgagcgaggcgtgcatgctcgccggcatg
gcgctcaagcgccgctggagccaacgccgtccggcgccgggcgcccggcccaacctggtc
atgggggtcaacgtccaggtctgctgggagaagttctgcaacttctgggaggtggaggcc
cggcaggtccccatggagggcgaccggttccacctcgatgcgcaggccgcggccgagctg
tgcgacgagaacaccatcggcgtcgtcggcatcctcggctccaccttcgacggctcctac
gagccgatcgccgacctctgcgcggccctcgacgcgctccaggagcgcacgggcctggac
ataccggtgcacgtcgacgccgcctccggcggcatgatcgcgcccttcctcgacgaggac
ctggtgtgggacttccgcctgccgcgcgtggcgtccatcaacacctcggggcacaagtac
ggcctggtctacccgggtgtcggctgggcgctgtggcgcgacaaggaggcgctgccggag
gagctcgtcttccgggtcaactacctgggcggcgacatgccgaccttcgccctgaacttc
tcccggcccggggcgcaggtggtcgcccagtactacacgttcctgcggctggggcgggag
ggctaccgcgccgtgcagcagacgacgcgcgacgtggcccggtccatcgccgaccgggtg
gcggcgctcggcgacttccggctgctgacgcggggcgacgagctgccggtcttcgcgttc
accacggcgccggaggtggaggcgtacgacgtcttcgacgtctcccggcggctgcgcgag
agcggctggctggtgcccgcgtacaccttcccgccgcaccgcgaggacctgtcggtgctg
cggatcgtgtgccgcaacggcttctcggcggacctggccgacctgttcgtggaggacctg
acccgcctgctgccggaactgcgccgccagccgcacccgttcacccgggacaaggaggcg
gccaccggcttccaccactag

DBGET integrated database retrieval system