KEGG   Streptomyces sp. CdTB01: AS200_26730Help
Entry
AS200_26730       CDS       T04240                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
scx  Streptomyces sp. CdTB01
Pathway
scx00620  Pyruvate metabolism
scx00680  Methane metabolism
scx01100  Metabolic pathways
scx01120  Microbial metabolism in diverse environments
scx01200  Carbon metabolism
Module
scx_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:scx00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    AS200_26730
  Energy metabolism
   00680 Methane metabolism
    AS200_26730
Enzymes [BR:scx01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     AS200_26730
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2
Motif
Other DBs
NCBI-ProteinID: ALV35243
UniProt: A0A0U3NV18
LinkDB All DBs
Position
5978894..5981626
Genome map
AA seq 910 aa AA seqDB search
MSSADDQTTTTSTELRADIRRLGDLLGETLVRQEGPELLELVEKVRRLTREDGEAAAELL
RGTELETAAKLVRAFSTYFHLANVTEQVHRGRELRARRAAEGGLLARTADRLKDADPEHL
RQTVAHLNVRPVFTAHPTEAARRSVLNKLRRIAALLETPVIASDRRRLDTRLAENIDLVW
QTDELRVVRPEPADEARNAIYYLDELHAGAVGDVLEDLTAELERVGLKLPDDSRPLTFGT
WIGGDRDGNPNVTPQVTWDVLILQHEHGINDALEMIDELRGFLSNSIRYTGATEELLQSL
QADLDRLPEISPRYKRLNAEEPYRLKATCIRQKLENTKQRLAKGTPHEEGRDYLGTSQLL
ADLTLVQNSLRAHRGDLFADGRMDRTIRTLAAFGLQLATMDVREHADAHHHALGQLFDRL
GEESWRYVDMPREYRARLLAKELRSRRPLAPTPAPVDAAGAKTLGVFETIKRALAVFGPE
VIESYIISMCQGADDVFAAAVLAREAGLIDLHAGWAKIGIVPLLETTDELKAADTILEDM
LSDPSYRRLVALRGDVQEVMLGYSDSSKFGGITTSQWEIHRAQRRLRDVAHRYGVRLRLF
HGRGGTVGRGGGPSHDAILAQPWGTLEGEIKVTEQGEVISDKYLIPSLARENLELTVAAT
LQASALHTAPRQSDEALARWDAAMDVVSDAAHAAYRWLVEDPDLPTYFLASTPVDQLADL
HLGSRPSRRPGSGVSLDGLRAIPWVFGWTQSRQIVPGWFGVGSGLKALREAGLDTVLDEM
HEQWHFFRNFISNVEMTLAKTDLRIAAHYVDTLVPDELKHVFDTIRAEHELTVREVLRVT
GESELLDATPVLKQTFAIRDAYLDPISYLQVALLKRQRDAAAAGEEPDPLLSRALLLTVN
GVAAGLRNTG
NT seq 2733 nt NT seq  +upstreamnt  +downstreamnt
gtgagcagtgccgacgaccagaccacgacgaccagcaccgagctgcgcgccgacatccgc
cggctgggcgacctcctgggcgagaccctcgtccgccaggagggccccgagcttctggaa
ctcgtcgagaaggtccgccgcctcacgcgcgaggacggagaggccgccgccgaactgctg
cgcggcaccgaactggagaccgcggccaagctggtccgcgccttctccacctacttccac
ctggccaacgtcaccgaacaggtgcaccgcggccgcgagctgcgcgcccgccgcgccgcc
gagggcggcctgctggcccgcaccgccgaccgcctcaaggacgccgaccccgagcacctg
cggcagacggtcgcccacctcaacgtccgccccgtcttcaccgcccaccccaccgaggcc
gcccgccgctcggtcctcaacaagctccggcgcatcgccgccctcctggagaccccggtc
atcgcctccgaccggcgccgcctcgacacccgtctggccgagaacatcgacctggtctgg
cagaccgacgaactgcgcgtcgtacggcccgaacccgccgacgaggcccgcaacgccatc
tactacctcgacgaactccacgccggcgccgtcggcgacgtcctcgaggacctgacggcg
gagctggaacgcgtcgggctgaagctgcccgacgacagccggcccctgaccttcggcacc
tggatcggcggcgaccgcgacggcaacccgaacgtcaccccccaggtcacctgggacgtc
ctcatcctccagcacgagcacggcatcaacgacgccctggagatgatcgacgagctgcgc
ggcttcctgtccaactccatccgctacaccggcgccaccgaggaactgctgcagtccctc
caggccgacctcgaccgcctccccgagatcagcccccgctacaagcgcctcaacgccgag
gagccctaccgcctcaaggccacctgcatccggcagaagctggagaacaccaagcagcgc
ctcgccaagggcaccccgcacgaggagggccgcgactacctcggcacctcccagctgctc
gccgacctcaccctcgtgcagaactccctgcgcgcccaccgcggcgacctcttcgccgac
ggccgcatggaccgcaccatccgcacactggccgccttcggcctccagctcgccaccatg
gacgtccgcgaacacgccgacgcccaccaccacgccctcggccagctcttcgaccgcctc
ggcgaggagtcctggcggtacgtcgacatgccccgcgagtaccgcgcccggctgctcgcc
aaggaactgcgctccaggcggccgctcgccccgaccccggcacccgtcgacgccgccggc
gccaagaccctcggcgtgttcgagacgatcaagcgggccctcgccgtcttcggacccgag
gtcatcgagtcctacatcatctccatgtgccagggcgccgacgacgtcttcgccgccgcc
gtcctcgcccgcgaagccggcctgatcgacctgcacgccggctgggcgaagatcggcatc
gtgccgctgctggagaccaccgacgagctcaaggccgccgacacgatcctggaggacatg
ctctccgacccgtcctaccggcgcctggtggcgctgcgcggcgacgtccaggaggtcatg
ctcggctactccgactcctccaagttcggcggcatcaccacctcgcagtgggagatccac
cgcgcccagcgccggctgcgcgacgtcgcccaccgctacggcgtgcgcctgcgcctcttc
cacggccgcggcggcaccgtcggccgcggcggcggcccctcccacgacgcgatcctcgcc
cagccctggggcaccctggagggcgagatcaaggtcaccgaacagggcgaggtcatctcc
gacaagtacctcatcccctccctggcccgggagaacctggaactgacggtcgcggccacc
ctgcaggcctccgccctgcacaccgcgccccgccagtccgacgaggccctcgcccgctgg
gacgcggccatggacgtcgtctcggacgccgcccacgccgcctaccgctggctcgtcgag
gaccccgacctgccgacgtacttcctcgcgtcgacgccggtggaccagctcgccgacctg
cacctgggctcccggccctcccgccgccccggctcgggcgtctcgctcgacggcctgcgc
gccatcccgtgggtcttcggctggacccagtcccgccagatcgtccccggctggttcggc
gtcggctccggcctgaaggcgctgcgcgaggccggcctcgacaccgtgctcgacgagatg
cacgaacagtggcacttcttccgcaacttcatctccaacgtcgagatgacgctcgccaag
accgacctcaggatcgccgcccactacgtcgacaccctcgtcccggacgagctcaagcac
gtcttcgacaccatccgcgccgaacacgaactgaccgtccgcgaggtcctgcgggtgacc
ggcgagagcgaactcctcgacgccaccccggtcctgaagcagaccttcgccatccgcgac
gcctacctggaccccatctcctacctccaggtggccctcctcaagcggcagcgcgacgcg
gccgccgccggcgaggagcccgacccgctgctctcccgcgccctgctcctcaccgtcaac
ggtgtggcggcgggcctgcgcaacaccggctga

DBGET integrated database retrieval system