KEGG   Streptomyces sp. CdTB01: AS200_27540Help
Entry
AS200_27540       CDS       T04240                                 

Definition
(GenBank) serine/threonine protein kinase
Organism
scx  Streptomyces sp. CdTB01
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kdo APH Kinase-like
Motif
Other DBs
NCBI-ProteinID: ALV35381
UniProt: A0A0U3PUJ3
LinkDB All DBs
Position
6181179..6182831
Genome map
AA seq 550 aa AA seqDB search
MRPVGSKYLLEEPLGRGATGTVWRARQRETAGAEAAVPGQPGETVAIKVLKEELANDADI
VMRFLRERSVLLRLTHPNIVRVRDLVVEGDLLALVMDLVEGPDLHRYLRENGPFSPVGAA
LLTAQIADALAASHADGVVHRDLKPANVLLAQNGGQMHPMLTDFGIARLADSPGLTRTHE
FVGTPAYVAPESAEGRPQTSAVDIYGAGILLYELVTGRPPFNGGSALEVLHQHLSAEPRR
PSTVPDPLWTVIERCLRKNPDDRPSAENLARALRVVAEGIGVHANSAQIAAADNVAVLLA
PDPAPAAVPGSADPTQVLPHTAGGFDPNAATNVMPTTGRPGPVGAADPTAVLPNTGAADP
TAVMPPVPQGQPGQQPEQPHPWQNQLRAARDRNEQTQVQYLDPNEDPLRRRPQRQVARPQ
QQPRPQQQRPPQRGPQGYGYPQQQPQQYAPPQHHQPQRYAPAPEPQRPVREPRQPRQPSP
NRMKIPGLGCLKGCLFMVVILFVAAWLVWELTPLQHWIGTGRGYFAELKHLYDNVSGWIG
DLSSKSGASN
NT seq 1653 nt NT seq  +upstreamnt  +downstreamnt
gtgcggccggtaggcagcaagtacctgctcgaggagccgctcggacgcggcgccacgggc
accgtctggcgagcccgccagcgagagaccgcgggggccgaggcggccgtacccggtcag
cccggcgagacggtcgcgatcaaggtcctcaaggaggagctcgcgaacgacgccgacatc
gtgatgcggttcctcagagagcgctccgtcctgctgcgcctgacccacccgaacatcgtc
cgggtccgcgacctggtggtggagggcgatctgctggcgctcgtcatggacctcgtcgag
ggccccgacctgcaccgctacctgcgggagaacggccccttcagccccgtcggcgccgcc
ctgctcaccgcccagatcgccgacgcgctcgccgccagccacgccgacggcgtcgtccac
cgcgacctgaagccggccaacgtgctgctcgcgcagaacggcggccagatgcacccgatg
ctcaccgacttcggcatcgcccgtctggccgactccccggggctgacccgcacccacgag
ttcgtcggcacgcccgcgtacgtggcgccggagtccgccgagggccgcccgcagacctcc
gccgtcgacatctacggcgccggcatcctgctgtacgagctggtcaccgggcgtccgccg
ttcaacggcggctccgcgctcgaagtcctccaccagcacctcagcgccgagccgcgccgc
ccctccacggtccccgacccgctgtggacggtcatcgagcgctgcctgcgcaagaacccg
gacgaccgacccagcgccgagaacctcgcccgcgctctgcgcgtggtcgccgagggcatc
ggcgtgcacgccaactccgcgcagatcgccgccgcggacaacgtcgccgtcctgctggcc
cccgacccggccccggccgcggtccccggctccgccgatcccacgcaggtcctcccgcac
accgcgggcggcttcgacccgaacgccgcgacgaacgtcatgccgaccaccggccgcccg
ggccccgtaggcgccgccgaccccaccgccgtactcccgaacacgggggccgccgacccg
accgcggtcatgccgccggtgccccaggggcagccggggcagcagccggagcagccgcac
ccgtggcagaaccagctgcgcgccgcccgcgaccgcaacgagcagacccaggtgcagtac
ctcgacccgaacgaggacccgctgcgccggcgcccgcaacgccaggtcgcccggccgcag
cagcagccccgcccccagcagcagcggccgccgcagcgcggcccgcaggggtacggctat
ccgcagcagcagccccagcagtacgccccgccgcagcaccaccagccccagcggtacgcg
cccgcgccggagccgcagcggcccgtccgtgagccccgccagccccgccagccgagcccc
aaccggatgaagatccccggcctcggctgcctcaagggctgtctgttcatggtcgtcatc
ctgttcgtcgccgcgtggctggtctgggaactcaccccgctgcagcactggatcggcacc
ggccggggctacttcgccgagctcaagcacctgtacgacaacgtcagcggctggatcggc
gatctgagcagcaagtccggcgcctccaactga

DBGET integrated database retrieval system