KEGG   Streptomyces sp. CdTB01: AS200_30535Help
Entry
AS200_30535       CDS       T04240                                 

Definition
(GenBank) galactose mutarotase
  KO
K01785  aldose 1-epimerase [EC:5.1.3.3]
Organism
scx  Streptomyces sp. CdTB01
Pathway
scx00010  Glycolysis / Gluconeogenesis
scx00052  Galactose metabolism
scx01100  Metabolic pathways
scx01110  Biosynthesis of secondary metabolites
scx01120  Microbial metabolism in diverse environments
scx01130  Biosynthesis of antibiotics
Module
scx_M00632  Galactose degradation, Leloir pathway, galactose => alpha-D-glucose-1P
Brite
KEGG Orthology (KO) [BR:scx00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    AS200_30535
   00052 Galactose metabolism
    AS200_30535
Enzymes [BR:scx01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.3  aldose 1-epimerase
     AS200_30535
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldose_epim TAT_signal
Motif
Other DBs
NCBI-ProteinID: ALV35902
UniProt: A0A0U3GAU4
LinkDB All DBs
Position
complement(6879384..6880538)
Genome map
AA seq 384 aa AA seqDB search
MELNRRTVIAGAAAAGIAATTLGTGSAEAASGGRKPVKELFGKLADGTKVYRWSLENGGT
RLRVLNWGGVVQCLEIPDRKGHYANVSLGFDNIDDYVAKTPYFGALIGRYGNRIAKGQFT
LDGKSYQLSVNDGDNSLHGGKQGFDKHIWDVEPFTKGSDVGLHLHYTSVDGEMGYPGTLK
AKVTYTLTKHGDWRIDYEATTDKATVVNLTSHVYWNLGGEGTGTIEDHELSIAASRYTPT
DSGLIPTGELAKVAGTPFDFRKTKTVGRDIRAGHVQQVQAKGYDHNWVLDKGITAKPEHV
ATLRDPRSGRTLKIATDQPGLQFYSGNFLDGTLTGTGGHTYRQGDALCLETQHFPDAPNH
PNFPSTVLRPGQTYRTSTIHTFGC
NT seq 1155 nt NT seq  +upstreamnt  +downstreamnt
atggaactgaacagacgcacggtcatcgcaggagccgcggcggcgggcatcgccgcgacc
accctcggcacaggcagcgccgaggccgcctcgggaggcaggaagccggtgaaggagctc
ttcggcaagctcgccgacggcaccaaggtctaccgctggtcgctggagaacggcggcacg
cggctgagggtcctcaactggggcggtgtcgtccagtgcctggagatcccggaccgcaag
ggccactacgccaacgtctccctcggcttcgacaacatcgacgactacgtggcgaagacc
ccgtacttcggcgcgctgatcggccgctacggcaaccgcatagcaaagggccagttcacc
ctggacggcaagagctaccagctgtccgtgaacgacggcgacaacagcctgcacggcggc
aagcagggcttcgacaagcacatctgggacgtcgagccgttcaccaagggctccgacgtc
ggcctccacctgcactacacgtccgtcgacggcgagatgggctacccgggcacgctcaag
gcgaaggtgacgtacaccctcaccaagcacggcgactggcgcatcgactacgaggccacc
accgacaaggccaccgtcgtcaacctcaccagccacgtctactggaacctcggcggcgag
ggcaccggcacgatcgaggaccacgagctgtcgatcgccgcctcccgctacacccccacc
gactcgggtctgatcccgaccggtgagctggcgaaggtggccggcacgcccttcgacttc
cgcaagaccaagacggtcggccgggacatccgcgccggccacgtgcagcaggtgcaggcc
aagggctacgaccacaactgggttctggacaagggcatcaccgcgaagcccgagcacgtc
gcgaccctgcgcgacccgcgctccggccgcaccctgaagatcgccaccgaccagccgggc
ctgcagttctactccggcaacttcctggacggcacgctcaccggcacgggcggccacacc
taccgccagggtgacgcgctgtgcctggagacccagcacttcccggacgcgccgaaccac
ccgaacttcccgtcgacggtgctgcgtcccgggcagacgtaccggacgagcacgatccac
accttcggctgctga

DBGET integrated database retrieval system