KEGG   Streptomyces sp. CdTB01: AS200_31055Help
Entry
AS200_31055       CDS       T04240                                 

Definition
(GenBank) aldehyde dehydrogenase
Organism
scx  Streptomyces sp. CdTB01
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh LuxC
Motif
Other DBs
NCBI-ProteinID: ALV35994
UniProt: A0A0U2WVY1
LinkDB All DBs
Position
6983820..6985277
Genome map
AA seq 485 aa AA seqDB search
MAELLEHGQLFIGGELTDPLGKDVIEVISPHTEEVIGRVPHASREDVDRAVAVARRAFDE
GPWPRMSLDERIAVVTWIKDAIAVRHEEIARVISSENGSPYSWSVLAQALGAMMVWDAAI
TVARDFTYEERRDGVLGKILVRREPVGVVAAVVPWNVPQFVAAAKLAPALLTGCSVILKP
SPESPLDAYILAEITKEAGLPEGVLSVLPADREVSEYLVGHPGIDKVSFTGSVAAGKRVM
EVAARNLTRVTLELGGKSAAVVLPDADVATTVAGVVPAAWMNNGQACVAQTRILVPRSRY
DEFAEAFSAAAGALVVGDPLDPATQVGPLVAQRQQRRNLDYIRIGQEEGAKILTGGGRPA
GLERGWYVEPTLFGDVDNSMRIAREEIFGPVICLLPYGDESEALKIANDSDYGLSGSVWT
ADVGHGIEVARQVRTGTYSVNTFSLDMLGPFGGYKSSGLGREFGPEGYGEYLEHKMIHLP
AGWEG
NT seq 1458 nt NT seq  +upstreamnt  +downstreamnt
atggccgagctcttggaacacggacagctgttcatcggaggggaactgaccgatcccctg
ggcaaggacgtcatcgaggtgatctcgccgcacaccgaggaggtcatcgggcgggtgccg
cacgcctcgcgggaggacgtcgaccgggcggtggcggtggcgcgccgggccttcgacgag
gggccctggccgcggatgtcgttggacgagcggatcgcggtggtcacgtggatcaaggac
gcgatcgccgtacggcacgaggagatcgcccgcgtgatctcgtccgagaacgggtcgccg
tactcctggagcgtcctcgcgcaggccctcggcgcgatgatggtgtgggacgcggcgatc
acggtcgcccgggacttcacctacgaggagcggcgcgacggcgtgctcgggaagatcctc
gtgcggcgcgagccggtcggcgtcgtggcggccgtggtgccctggaacgtcccgcagttc
gtggcggccgccaagctcgcgcccgccctgctcaccggctgctcggtgatcctcaaaccg
tcgcccgagtcgccgctggacgcgtacatcctggcggagatcaccaaggaggccgggctg
ccggagggtgtgctgtccgtgctgcccgccgaccgggaggtcagcgagtacctggtcggg
catcccgggatcgacaaggtctccttcaccggatcggtcgccgccggcaagcgcgtgatg
gaggtcgccgcgcgcaacctcacccgcgtgacactggagttgggcggcaagtcggcggcc
gtcgtgctgccggacgcggacgtggcgaccacggtcgcgggggtcgtacccgcggcctgg
atgaacaacggccaggcgtgcgtggcccagacccgcatcctggtgccgcgctcccgctac
gacgagttcgccgaggcgttctccgccgcggccggcgccctcgtggtcggcgacccgctc
gacccggcgacccaggtcggcccgctcgtcgcgcagcgccagcagcgccgcaacctcgac
tacatccgcatcggccaggaggagggcgccaagatcctcacgggcggtgggcgtccggcg
ggcctggagcggggctggtacgtggagcccacgctcttcggcgacgtcgacaactcgatg
cggatcgcgcgggaggagatcttcggcccggtcatctgcctgctgccctacggcgacgag
tccgaggccctgaagatcgccaacgactcggactacggactgagcggcagcgtgtggacg
gcggacgtcggtcacggcatcgaggtggcacggcaggtgcggacggggacgtactcggtg
aacaccttcagcctcgacatgctgggcccgttcggcggctacaagagcagcggtctgggg
cgggagttcgggcccgaggggtacggggagtacctggagcacaagatgatccacctgccg
gccggctgggagggctga

DBGET integrated database retrieval system