KEGG   Streptomyces sp. CdTB01: AS200_45600Help
Entry
AS200_45600       CDS       T04240                                 

Definition
(GenBank) DNA ligase
Organism
scx  Streptomyces sp. CdTB01
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_ligase_A_M RNA_ligase
Motif
Other DBs
NCBI-ProteinID: ALV39360
UniProt: A0A0U3PBV3
LinkDB All DBs
Position
unnamed:269803..270681
Genome map
AA seq 292 aa AA seqDB search
MDFPVDVALAELVPTLPVGAGWRYEMKLDGHRTVVWREEDTVRLQARSGRDVTAVWMDLA
LAALDMLPPGVVLDGEAVIYAHGRIDFAAAQSRALSTPARARRLSEALPAHFAAWDILSH
PEHGDVRARPYDERRALLVDLLQEYNVKPPIQLVPMTDDPTVAMTWYQQLPEQGIEGIVA
KRATSTYKAGRIWKKIRHAETVEADVVGYTGPAARPRALAVRLPDGRIALTQSLKAPLAA
QVAVHFTASGPPRSARTRAGETYTTTAPGLVVEVLAGTTRHAVVTVTRLRST
NT seq 879 nt NT seq  +upstreamnt  +downstreamnt
gtggacttccccgtcgacgtcgccctcgccgagctcgtcccgaccctgccagtcggggcg
ggctggcggtacgagatgaagctcgacggccaccggacggtcgtctggcgtgaggaagac
accgtccggctccaggcccgttccgggcgagacgtcaccgcggtgtggatggacctggcc
ctcgcggccttggacatgctcccgccgggtgtggtcctcgatggcgaggcagtgatctac
gcccatgggaggatcgacttcgcggccgcgcagtcgcgcgccctgtccacccccgcccgg
gcgcgccgcctctccgaggccctgcccgcccacttcgcggcctgggacatcctgtcccac
cccgagcacggcgacgtccgggcacgtccgtacgacgagcgccgcgcccttctcgttgac
ctgctgcaggagtacaacgtcaagccgccgatccagctggtcccgatgaccgacgacccc
acggtcgccatgacctggtaccaacaactcccggagcaggggatcgagggcatcgtcgcc
aagcgggccacctccacctacaaggcgggccggatctggaagaagatcaggcacgccgaa
accgtggaggccgacgtcgtcggctacaccggaccggccgccaggccgcgggcactcgcg
gtccgcctccccgacggacgaatcgcgctcacccagtccctgaaagctccgctcgccgcc
caggtcgcggtgcacttcaccgccagcggcccgccgcgcagcgcacgcacccgagcgggg
gagacctacaccaccaccgctcccgggctcgtagttgaggtcctggccgggacgacccgg
cacgccgtggtgacggtcacccggctgcgcagcacatga

DBGET integrated database retrieval system