KEGG   Streptomyces cattleya NRRL 8057 = DSM 46488: SCATT_14190Help
Entry
SCATT_14190       CDS       T02095                                 

Definition
(GenBank) aldehyde dehydrogenase
Organism
scy  Streptomyces cattleya NRRL 8057 = DSM 46488
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: AEW93790
UniProt: F8K377
LinkDB All DBs
Position
complement(1540150..1541616)
Genome map
AA seq 488 aa AA seqDB search
MTEAAVMEYKQLYIGGELTDPAGGEVIEVISPHTEEAVGRVPAACPADVDRAVAAAREAF
DHGPWPRTPIGERIAVVTRIKDALAARHEEVARLISTENGSPYGWGVFAQALGAVLVWDA
ALTVARDFVAEEPRAGVLGPLLVRREPVGVVAAVVPWNVPQFVAAAKLAPALLAGCPVIL
KPSPETPLDAYLLAGIAAEAGLPPGVLSVLPAGRETSEYLVGHPGVDKVSFTGSVATGKR
VMEVAARNLTRVTLELGGKSAAIVLPDADLDAAVAGIVPNAWMNNGQACVAQTRILAPRR
HYAEIADRLTAAARALVVGDPLDPATQVGPLVARRQQRRSLDYVELGRREGATVLTGGGR
PAGLPKGWYVEPTLFGDVANTMRVAREEIFGPVVCLVPYEDEEEAVRIADDSDYGLSGSV
WTADVERGVEIARRIRTGTYSVNTFSLDMLGPFGGFKNSGLGREFGPEGFAEYLEHKMIH
LPAGEGAA
NT seq 1467 nt NT seq  +upstreamnt  +downstreamnt
atgaccgaagcggccgtcatggagtacaagcagctctacatcggcggggagctgaccgac
cccgcgggcggcgaggtgatcgaggtgatctcgccgcacaccgaggaggccgtcggacgg
gtccccgcggcctgcccggccgacgtcgaccgggcggtggccgccgcccgcgaggcgttc
gaccacgggccctggccgcgtaccccgatcggcgagcggatcgcggtggtgacccggatc
aaggacgccctcgccgcgcgccacgaggaggtcgcccggctgatcagcacggagaacggc
tccccgtacggctggggggtcttcgcgcaggcgctcggcgcggtgctggtgtgggacgcg
gcgctcaccgtggcccgcgacttcgtggccgaggaaccgagggccggggtgctcgggccg
ctgctggtgcgccgggagccggtgggcgtggtggccgcggtggtgccgtggaacgtcccg
cagttcgtggccgccgccaagctcgcgcccgcgctgctggccggctgtccggtgatcctc
aagccctccccggagaccccgctcgacgcgtatctgctggccgggatcgccgccgaggcc
gggctgccgcccggggtgctctcggtgctgccggccgggcgggagaccagcgagtacctg
gtcggccaccccggcgtcgacaaggtctccttcaccggctcggtcgccaccggcaaacgc
gtcatggaggtcgccgcccgcaacctgacccgggtcacgctggaactcggcggcaagtcc
gccgcgatcgtcctccccgacgccgacctggacgccgcggtggccggcatcgtccccaac
gcctggatgaacaacggccaggcgtgcgtcgcgcagacccgcatcctcgcgccgcgccgc
cactacgccgagatcgccgaccgcctcacggccgccgcccgcgcgctggtggtcggcgac
ccgctggacccggccacccaggtcggcccgctggtcgcccgccgccagcagcggcgctcc
ctcgactacgtcgaactcggccgacgcgagggcgccaccgtcctgaccggcggcggacgc
ccggccggcctgcccaagggctggtacgtcgagccgaccctcttcggcgacgtggccaac
accatgcgcgtcgcccgcgaggagatcttcggcccggtcgtctgcctggtgccctacgag
gacgaggaggaggcggtccgcatcgccgacgactccgactacgggctctccggcagcgtg
tggaccgccgacgtggaacgcggcgtcgagatcgcccgccggatccgtaccggcacctac
tcggtgaacaccttcagcctcgacatgctcggccccttcggcggcttcaagaactccggc
ctgggacgggagttcggccccgaggggttcgccgaatacctggagcacaagatgatccac
ctgccggccggggagggcgccgcgtga

DBGET integrated database retrieval system