KEGG   Streptomyces cattleya NRRL 8057 = DSM 46488: SCATT_19880Help
Entry
SCATT_19880       CDS       T02095                                 

Definition
(GenBank) serine/threonine protein kinase
Organism
scy  Streptomyces cattleya NRRL 8057 = DSM 46488
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Trypan_PARP Kdo APH Pkinase_fungal
Motif
Other DBs
NCBI-ProteinID: AEW94359
UniProt: F8JUE7
LinkDB All DBs
Position
complement(2102777..2104459)
Genome map
AA seq 560 aa AA seqDB search
MRPVGSKYLLEEVLGRGATGTVWRARVRETVYPQGGGAGTASQAGEVVAIKVLKEELAGD
ADIVMRFLRERSVLLRLSHPNIVRTRDLVVEGELLALVMDLVDGPDLHRYVRENGPFSPA
GAALLTAQIADALAASHADGVVHRDLKPANVLLAATPDGSQMHPMLTDFGIARLADSPGV
TRTHEFVGTPAYVAPESAEGRPQTSAVDVYGAGILLYELATGRPPFRGESALEVLHQHLS
ADPRRPSTMPEPLWTVIERCLRKNPDERPSAVSLARALRVVAHGIGVHATPEAAETALGV
AALLAPDPRPARVPGTGAAMAGPDADPTQVLPAGGQADPTQVLPGGSRGLSAGDPEAATS
LLPPTAGADGAGPAGGTRVMPPMPPEQPGAQGPHPWESQLNAARQRNEQTELGYLDPAQD
PLRHRPRRRPGPPAAGYGARPAPPPPQRYEPEPPRYQPSRRPEPEPAPRREPPPRREPAP
RREPRPRSRMRIPGAGCLKGCLFTIVVLVVVAVLVWNFTPLPEWVAKGRSLWETASSLVS
TAWHWVSTIGSAAHDLNQGN
NT seq 1683 nt NT seq  +upstreamnt  +downstreamnt
gtgcggccggtaggcagcaaatacctgctcgaggaggtgctcgggcgaggagccacgggc
accgtctggcgggcccgggtccgcgagacggtgtacccccagggcggcggcgccggcacc
gcgtcacaggccggcgaggtcgtcgccatcaaggtgctcaaggaggagctggccggcgac
gcggacatcgtcatgcgtttcctccgggagcgctcggtgctgctccggctctcccacccc
aacatcgtgcgcacccgcgacctggtggtcgagggggagctgctggccctggtgatggac
ctggtcgacggtccggatctccatcgctatgtgcgggagaacggcccgttcagcccggcc
ggcgcggcgctgctgaccgcgcagatcgccgacgcgctcgccgccagccacgccgacggc
gtcgtgcaccgcgacctgaagcccgccaacgtcctgctcgccgccaccccggacggctcg
cagatgcacccgatgctgaccgacttcggcatcgcccggctggcggattcgcccggagtc
acccgtacgcatgaattcgtgggcacccccgcgtacgtcgcgccggagtccgccgagggg
cgcccgcagacctcggcggtggacgtctacggcgccggcatcctgctgtacgagctggcc
accggccgtccgccgttccgcggcgagagcgccctggaagtgctccaccagcatctgagc
gccgacccgcgccgtccgtccaccatgcccgagccgctgtggacggtgatcgagcgctgt
ctgcgcaagaaccccgacgagcggcccagcgccgtcagcctcgcccgggcgctgcgcgtg
gtggcccacggcatcggggtgcacgccaccccggaggccgccgagacggcgctgggcgtc
gccgcgctgctcgcccccgacccgcggccggcccgggtccccggcaccggcgccgccatg
gccggcccggacgccgacccgacccaggtgctcccggccggcggccaggccgaccccacg
caagtgctgcccggcggcagccgcggcctgtccgcgggcgacccggaggcggccaccagc
ctgctgccgcccaccgcgggcgccgacggtgccgggccggccggcggcacccgggtgatg
cccccgatgccgccggagcagcccggcgcgcagggcccgcacccgtgggagtcccagctc
aacgcggcccggcagcgcaacgagcagaccgagctgggctacctcgaccccgcgcaggac
ccgctgcgccaccggccgcgccgccgcccggggccgcccgccgccggctacggcgcccgc
ccggccccgccgccgccccagcggtacgaaccggagccgccgcgctaccagccgtcccgg
cggcccgagccggagccggccccgcgccgggagcccccgccccgccgggagcccgccccg
cgccgcgagccgcgtccgcgcagccggatgcgcatccccggcgccggctgcctcaagggg
tgcctgttcaccatcgtcgtcctggtggtcgtcgcggtgctggtgtggaacttcaccccg
ctgccggagtgggtggccaagggccgttcgctgtgggagaccgcctccagcctggtcagc
accgcctggcactgggtctccacgatcggttccgcggcgcacgacctgaaccaaggaaac
tga

DBGET integrated database retrieval system