KEGG   Streptomyces cattleya NRRL 8057 = DSM 46488: SCATT_32680Help
Entry
SCATT_32680       CDS       T02095                                 

Definition
(GenBank) type I polyketide synthase
Organism
scy  Streptomyces cattleya NRRL 8057 = DSM 46488
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ketoacyl-synt Acyl_transf_1 KR Ketoacyl-synt_C PS-DH KAsynt_C_assoc PP-binding adh_short Thiolase_N Epimerase ACP_syn_III GDP_Man_Dehyd SAT
Motif
Other DBs
NCBI-ProteinID: AEW95639
UniProt: F8JUL0
LinkDB All DBs
Position
3448016..3465868
Genome map
AA seq 5950 aa AA seqDB search
MTDHSRDGSPATTASDEPIAVIGMACRLPGADGPEAFWRLLRTGTDAIGEVPEGRYDPAV
LAGPDGDRIRHGGFIDRPEEFDAAFFGISPAEALAMDPQQRLVLELAWEALEDARIVPAR
LAGADTGVFIGATWDDYARLLHEYGPGALDHYRLTGVNRGLLANRVSYALGLRGPSLALD
SAQSSSLVAVHAACASLRSGESTLALAGGVNLNLVADSALALARLGALAPDGRARVFDAH
AGGTVRGEGGAVVVLKPLTAALADGDPVYCVIKGSAVNNDGATDGITTPGRQAQSAVLRA
ACRRAGVDPARLQYVELHGTGTAVGDPVEARAIGAVTAPGRPAGHPLRVGSVKTNLGHLE
GAAGIVGLLKVALTIRHRQLVPSLHYDTPNPAIDLDALRLRVQTATEPWPAADQPLLAGV
TSLGIGGTNCHVVLGEAPSAAATPDTPAGVHAAVPWVISGRTDAAVRAQAGRLAEYVAGR
DTAGPAEVGLALATTRTHFEHRAAVVGAERDELLAGLRALAEGTPERNAVTGRRTKGRLA
VLFGGGGSQRVGMGRELAAAYPVFAAAFDEVCDHLDRHLDRPVRGLIHAAPGTPEAELLD
RTDYALPALLAVEVALYRLYESWGVTPDYLTGHSMGELAAAHIAGVLTLPDVCALAVARA
RLIQSRAGGAMAAVQAGEEEILAHLDEYADAVSVAAVNSPDGTVISGDEDAVVALCARWR
ERGRKTKRIAVTVAGHSPHMDAILDDFRQVAAALDYAPPTIPVVSNVTGRIATDEELTSP
DYWVRHIRATVRFADGIRTLGDAGVTTYLELSPSPVLTQAVTTTLEGRQPRPVTVPALQA
DRPEAHSAVTALARLHTAGVTWRPDALFPAGTAPCDLPTYAFQRRRYWPDPAGRTRHATT
GALTADHPGDVTGSADEPEATSALRHRLAGLTDSAAHRLLLDLVTSTAAVVLQRPDTEPL
DPELPFRDQGVTSLTAVELRNALETATGLALPATLVFDHPTPSALAGFLRGEVTGAVEAA
EAVVVASVDEPIAIVGMGCRFPGEVSSPEGLWRLVAEGRDAISGFPENRGWDLEGLYDPD
PQRRGTSYTRHGGFLHDADRFDAEFFGISPREALATDPQQRLLLETAWEAVERAGIDPTT
LRGSRTGVFAGVMAPDYGPRLHEAGSGTDGYLLTGSAGSVASGRIAYTLGLEGPAVSVDT
ACSSSLVAMHLAAQALRQGECTLALAGGVTVMATPGTFVEFSRQRGLSADGRCKAFSDDA
DGTGWGEGVGVLLLERLSDARRNGHRVLAVIRGSAVNQDGASNGLTAPNGPSQQRVIRQA
LAAAGLDAVDVDAVEAHGTGTRLGDPIEAQALLAAYGQGRGRPLWLGSVKSNIGHTQAAA
GVAGVIKMVMAMRHGVLPRTLHVDAPSSRVEWSSGAVELLTEAVAWEREGGPRRAGVSSF
GISGTNAHVIIEEPEDTAEQAETLPEPGDRVVPWVVSAATPEALRRQAARLRDALGQDPE
AGPDAVAHALATTRAALDHRAVVVGADRAALLAGLDSLAQGATTPDVRTGQARRPGKTAF
VFSGQGSQRVGMGRGLYEAFPVFAAAFDEVCAGFEGLVDVPVRDVVFGDDAEVLDRTRST
QPALFAVQVALFRLVSSWGLVPDAVIGHSVGEVAAAFVAGVWSLPDACRLVAARGRLMDA
ARSGGAMAAVQGPESEVRSALVAGVEVAAVNGPEATVVSGDREAVEALVAAWKGRGRRAS
LLRVSHAFHSAHMDGVLEEFRSVVGGLGYAEPSVPVVSNVTGEVAGPGVLTSPEYWVRHI
REAVRFADGIRALNDQGVTTFFEVGFDATLTPAVAASAPDAGTAAIALVRRDEPEPVSLL
TALADGYVRGAGVDWPAVLGPGRRRPVELPTYPFAGERYWLAPSAPGGDATTLGLDDTGE
HPLLGAAVSAADGDSLLLTARLSLRTHPWLADHTVAGAVLLPGTAFVELALQAARRAGCD
EVEELTLEAPLVVPETGAVRLQVAVGAPDAAGRRPVTVHSRPQGAPDDPPWTRHATGALA
PAGPAPAAEAPAAWPPAGAVPVDLTDAYPRLAGLGYAYGPLFQGLTALWRDGAGLCAEVR
LPEAAAPDAERYALHPALLDAALHALVLDPADQAATRLPFAFTGVRVHAVGATALRVRLT
PAGGSHTARLTLTDGAGQPVASIASLALRPVDPAALAAARRAGRALYAVEWVPAPPSDGT
TAPELTFIEPVTATGDVLADTHCSVPAAHGALRAWLAGDPAPGARLAVVTRGALADGPGA
PAAAAVWGLVRSAQSEHPDRFVLVDMADDTEVPHDLVAAAVAAGESQLVVREGALSVPRL
IRLPAADDPDAPALDPDGTVLITGGTGTLGALVARHLVTRHGVRHLLLVGRRGRQAPGAS
QLADELRALGASVEVAARDTADRDAVAALLASVPAGRPLTAVVHAAGVLDDGTLESLTPE
RLAGVMRPKADAAWHLHELTRGADLAAFVLFSSVAGTLGTAGQANYAAANAFLDALARHR
RALGLPATSVAWGLWAEASGMTGGLGDADQARLRRAGVAAMPTEQGLAAFDAALAGTGRP
DPVAARLDPAGLRAGAGNRPLPVLFRTLFPAATQRRAADVPTAGSWADRIRALPAAERDA
ALLSLVRAQVATVLGHARAEAVPADRVFNDLGFDSLTAVELRNRLAETTGLRLPPSLLFD
HPTPSALAGFLRGEVTGAVEAAEAVVVASVDEPIAIVGMGCRFPGDVSSPEELWRLVAEG
RDAISGFPENRGWDLEGLYDPDPQRQGTSYTRHGGFLHDADRFDAEFFGISPREALATDP
QQRLLLETAWEAIERAGIDPTTLRGSRTGVFAGVMYNDYGSRLQPAPAGFEGFLLAGNTG
SVASGRVAYTLGLEGPAVSVDTACSSSLVAMHLAAQALRQGECTLALAGGVAVMSTPNTF
IEFSRQRGLAADGRCKAFSDDADGTGWGEGAGFVLLERLSDARRNGHPVLAVIRGSAVNQ
DGASNGLTAPNGPSQQRVIRQALAAAGLTEADVDAVEAHGTGTRLGDPIEAQALLATYGR
HHDPERPLWLGSIKSNIGHTQAAAGVAGVIKMTMAMRHGVLPRTLHADTPSSRVDWSSGA
VALLTEPVPWQPGTRPRRAAVSSFGISGTNAHLILEEPAEEPAERPAAKATGPVPLVLTA
RGERPLRQLGERLREVLAEDSGADPAAVGRALLTGRSVFDHRAVVLTDDTTGHLDALAAL
ATGRPHPALVTGTAPATGGGTVFVFPGQGSQWTGMALELLDASEAFHERMRQCADALAEF
TDWDLFEVLRGAPGAPGYDRVDVVQPVLFAVMVSLAALWESAGVRPDAVVGHSQGEIAAA
CVAGALTLRDAARVVALRSRALAELAGTGGMVSVPLPAEDVERRIRRWNGRLAVAAVNSP
GSAVVAGDPEALDELLAACAAGGVRARRIPVDYASHSPHVEAIRDRLLDLLAPVAPRPAD
VPFCSAVTGAVLDTTVLDAAYWYRNLRQPVRFDTATRALLDSGHRTFVEVSAHPVLTMAV
QDTFAAHPDPKVPEEATALGTLRRDDGGPDRFHASAAEGYVCGLPVDWARLTGATAPGRH
VDLPTYPFQHESYWLEPAPRTGDMAAAGLTTAGHPLLGAAVDLGDGHGTVFTGRLATRTH
PWLADHAVAGTVLLPGTAFVELALHAARQAGCDRLDDLTVTAPLVFPDGAAVRLRITVDG
PGPDGRRHLTVHSRPDDDTPDAPWTRHATGVLASGPAPAAEGTPAAWPPPGAVPVDLTDA
YPRLAARGYAYGPAFQGLRAAWRTDGEVYAEVTAATGVDGYGLHPALLDAALHPVVLGAL
GDLDDDVLPFSWSGVTLHAVGATTLWVRLRAAGSGTVAVDVADATGAPVARVESLALRPL
DRAALNEGARPRLPLLRLAWEDARLGAPGADRPDLLTATPDGGDPARAARTATAEVLAAL
RERVADPDAAPLAVVTRRAVVLPGDGHAPDPAAAAVWGLVRSAQSEHPGRFLLVDTADDT
EPAHDALAAALAAGEPQLALRGGTFTVPRLTRLPGADDPDAPALDPDGTVLITGGTGTLG
RLIARHLVTRYGVRRLLLLSRRGAEAPGAAGLVAELAASGAEAVVEACDTADRDALAGVL
ARIPAGHPLTAVIHTAGVLDDATLEALTPERLATVLRPKADAAWHLHELTRDADLAAFVL
FSSAAGVLGTAGQGNYAAANAFLDALAALRHAQGLPATSMAWGLWAEASGMTGALTGADQ
ARLGRAGIAPLTEEQGLALFDAALAAPEPLTVPARLDTAALARATGPVPAVLRALVRVPA
LPTANGAGTPAAATGLAGRLRDLSEDERRRLLRDLVSGQVATVLGHADPDSVPADRPFTE
LGFDSLIAVELRNRLGEATGLRLPASLVFDHPTVAALTAFVHGELTGAAPAAEAVPVVSA
VDEPIAIVGIGCRFPGDVSSPEELWRLVAEGHDAVSDFPEDRDWDLDALCHPDPDHHGTF
YARHGGFLHDAARFDAEFFGISPREALATDPQQRLLLETAWEAVERAGIDPTTLRGSRTG
VFAGVMYNDYGSRVTDPPKDLEGYLVNGSSGSVASGRVAYTLGLEGPAVSVDTACSSSLV
AMHLAAQALRQGECSLALAGGVTVMSTPTTFIEFSRQRGLSADGRCKAFAESADGTGFSE
GAGLLLLERLSDARRNGHRVLAVIRGSAVNQDGASNGLTAPNGPSQQRVIRQALAAAGLD
AVDVDAVEAHGTGTRLGDPIEAQALLAAYGQGRGRPLWLGSVKSNIGHTQAAAGVAGVIK
MVMAMRHGVLPRTLHVDAPSSRVEWSSGAVELLTEAVAWEREGGPRRAGVSSFGISGTNA
HVIIEEPEDTPVAVVGTAEEPEAPVMWTVSAPTEAGLRAQAARLAEHAEAHPDTPVTATG
LALATTRTLFAHRGAVVGRNHKELTDALRALAEGRTLTHAVHGTAADTRLAFVFSGQGSQ
RVGMGRGLYEAFPVFAAAFDEVCAGFDGLVDLPVRDVVFGADAEVLDRTRSTQPALFAVQ
VALFRLVSSWGLVPDAVVGHSVGEVAAAFVAGVWSLPDACRLVAARGRLMDAARSGGAMA
AVQGPESEVRSALVAGVEVAAVNGPEATVVSGDREAVEALVAAWKGRGRRASLLRVSHAF
HSAHMDGVLEEFRSVVGGLGYAEPSVPVVSNVTGEVAGPGVLTSPEYWVRHIREAVRFAD
GIRALHDQGITTYLELSGHPVLAHDIGNTLQEAAPGGRTTVIGARPTPDGVMTALAQAHV
AGVAFDRAALHPAGTVPAELPTYAFGGRRYWLAATPAATPTAPAAPEDGGHPLLGPATEL
AGGGTVHTARLSRRTHPGLGDAPPATGTLLPPDAVPLVLVRREPLRLPAEGALDVQLTLG
EPDAGGHRPVTVHSRPAPANGARWTLHAEGTLAAHPAPADPAPALHQVDWVRVPSARTGQ
SAESAESVEEFTYRPADPAALHDLLERVRRHLADGRARLAVVTEGAVAVGGEPVADPAAA
TAWGLVRAVQSEHPGRLVLLDTDAAAASRAAVADALATGEPQLALRDGTVHAPRLVRAPA
AAGTPAALRPDGTVLITGGTGALGALVARHLVARHGARHLLLVGRRGPQAPGASQLADEL
RVLGASVEVAACDTADRDAVAALLASVPADRPLTAVVHAAGVLDDATVEALTPERLDAVL
RPKADAARHLHELTREADLAAFVLFSSLAGVVGNAGQANYAAANAYLDALAQHRAAEGLP
GLSLSWGLWHGDAEGIGMAATLSGADAERMGRSGVAPMAAEEALALFDAALAHGRAHLVP
AAFDGAALAARAAAGTLPPLLTGVVPPTAEPAGSAPEPETAPRPALDPAALHDLVLTTVA
DVLGFDSPEEVDTEEELVDLGIDSLMAVELRNRLAEATGVQLPASMVYDFPTVDALAERL
AEGTGDPAAG
NT seq 17853 nt NT seq  +upstreamnt  +downstreamnt
atgaccgaccacagccgtgacggcagcccggcaacgacggcgtcggacgagccgatcgcc
gtgatcggcatggcgtgccgactccccggggcggacggccccgaggcgttctggcggctg
ctgcgtaccggcaccgacgccatcggcgaggtccccgaaggccgttacgaccccgccgtg
ctcgccgggccggacggcgaccgcatccgccacggcggcttcatcgaccgcccggaggag
ttcgacgccgcgttcttcggcatctcgcccgccgaggcgctcgccatggacccgcagcag
cgcctcgtcctcgaactcgcctgggaggcgctggaggacgcccggatcgtcccggcccgg
ctggccggcgccgacaccggtgtcttcatcggcgccacctgggacgactacgcccggctg
ctccacgagtacggccccggcgccctcgaccactaccgcctcaccggcgtcaaccgcggc
ctgctcgccaaccgcgtctcctacgccctcgggctgcgcggccccagcctcgcgctggac
agcgcccagtcctcctcgctggtggccgtgcacgccgcctgcgccagcctgcgctccggg
gagtccaccctcgccctggccggcggggtcaacctcaacctcgtcgccgacagcgccctc
gccctcgcccggctcggcgcgctggccccggacggccgcgcccgcgtcttcgacgcccac
gcgggcggcacggtacgcggcgagggcggcgccgtcgtcgtcctcaagccgctgaccgcc
gcgctggccgacggcgacccggtgtactgcgtcatcaagggcagcgcggtcaacaacgac
ggcgccaccgacgggatcaccacccccggccgacaggcccagagcgccgtcctgcgcgcc
gcctgccgccgcgccggggtcgacccggcccgcctccagtacgtcgaactgcacggcacc
ggcaccgccgtcggcgaccccgtcgaggcccgggcgatcggcgccgtcaccgcccccggc
cgccccgccggccacccgctgcgggtcggctccgtcaagaccaacctcggccacctcgaa
ggcgccgccggcatcgtcggcctgctcaaggtcgcgctcaccatccgccaccgccaactc
gtccccagcctccactacgacacccccaaccccgccatcgacctcgacgccctccgcctg
cgcgtccagaccgccacggaaccctggccggccgccgaccagccgctgctggccggggtg
acatcgctcggcatcggcggcaccaactgccatgtggtgctcggcgaggcgccgtcagcg
gcggccacgccggacacgcccgccggggtccacgccgccgtcccctgggtgatctccggg
cgcaccgacgccgccgtgcgggcccaggccggacggctggccgagtacgtggcggggcgg
gacacggcggggccggccgaggtggggctggcgctcgccacgacgcgtacgcatttcgag
caccgggccgccgtcgtcggggcggagcgggacgaactcctcgcggggctgcgcgcgttg
gccgagggtacgccggagcggaacgccgtcacgggccgccggactaaggggcggctcgcg
gtgctcttcgggggcggcgggagccagcgggtcgggatgggacgcgaactcgccgccgcg
tacccggtgttcgccgccgcgttcgacgaggtctgcgaccacctcgaccgccacctcgac
cggccggtgcgggggttgatccacgccgcgcccggcacccccgaggcggagctgctggac
cgcacggactacgcgctgcccgccctgctcgccgtcgaggtcgccctctaccggctctac
gagagctggggcgtcacccccgactacctcaccggccactccatgggcgagctggccgcc
gcccacatcgccggggtgctgacgctgccggacgtgtgcgcgctggccgtcgcccgcgcc
cggctcatccagtcccgggccggcggcgccatggcagccgtccaggcgggcgaggaggag
atcctcgcccacctcgacgagtacgccgacgccgtctccgtcgccgcggtcaactccccg
gacggcaccgtgatctccggcgacgaggacgccgtggtggcgctgtgcgcccggtggcgg
gaacggggccgcaagaccaagcggatcgccgtcaccgtggccggccactccccgcacatg
gacgccatcctggacgacttccgccaggtcgccgccgccctcgactacgcaccgccgacg
atcccggtggtctccaacgtcaccggccggatcgccaccgacgaggagctgacctcaccc
gactactgggtgcggcacatccgcgccaccgtgcggttcgccgacggcatccgcacgctg
ggcgacgcgggcgtcaccacgtacctggaactgtcgccctcaccggtgctcacccaggcc
gtcaccaccaccctggagggacggcagccgcgcccggtgaccgtccccgcgctccaggcc
gaccgccccgaggcacacagcgccgtcaccgccctcgcccggctgcacaccgccggcgtc
acctggcgtcccgacgccctcttcccggccggcaccgccccgtgcgacctgcccacctac
gccttccagcgccgccgctactggcccgacccggccggccgcacccggcacgccaccacc
ggcgcgctcaccgccgaccaccccggcgacgtcaccggatccgccgacgaacccgaggcc
acctcggcgctgcgccaccggctcgccggactcaccgacagcgccgcccaccgcctcctg
ctcgacctcgtcacctcgaccgccgccgtcgtcctccaacgccccgacaccgaacccctc
gaccccgaactccccttccgcgaccagggcgtcacctccctgaccgccgtcgaactgcgc
aacgccctggagaccgccaccggcctcgccctgcccgcgacgctcgtcttcgaccatccg
acgccgtcggctctggcgggtttcctgcggggtgaggtgacgggtgcggtggaggcggcc
gaggccgttgtggtggcttcggtggacgagccgatcgccattgtgggcatggggtgtcgt
ttcccgggtgaggtgtcgtcgccggaggggttgtggcggctggtggccgaggggcgggac
gcgatttcggggttcccggagaatcgtgggtgggatctggaggggttgtacgatccggat
ccgcagcggcgggggacgtcgtacacgcggcatggtggtttcctgcatgacgcggaccgg
ttcgacgcggagttcttcggtatctcgccgcgtgaggcgttggcgaccgatccgcagcag
cggttgttgctggagacggcgtgggaggcggtcgagcgggccgggatcgacccgacgacg
ctgcgtggttcgcgtaccggtgtcttcgccggggtgatggcccccgactacggcccccgg
ctgcacgaggccggctccggcaccgacggatacctgctcaccggcagcgcgggcagcgtg
gcctccggccggatcgcgtacacgctgggtcttgagggtccggcggtgagtgtggacacc
gcgtgttcgtcgtcgctggtggcgatgcacctggcggcgcaggcgctacggcagggcgag
tgcaccctcgcgctcgccggtggtgtcaccgtgatggcgacaccgggcaccttcgtggag
ttcagcaggcagcgcgggctgtcggcggacggccgctgcaaggcgttctccgacgacgcc
gacggcacggggtggggtgaaggcgtcggcgtactgctgttggaacgcctctccgacgcg
cggcgcaacggtcatcgggtgctcgcggtgatccgggggagtgcggtcaatcaggatggt
gcgtccaacgggttgacggcgcccaatggtccgtcgcagcagcgggtgatccggcaggcg
ttggcggcggccgggttggacgcggttgatgtggatgcggtggaggcgcatggtacgggg
acgcgtcttggtgatccgatcgaggctcaggcgttgttggctgcgtatggccaggggcgt
gggcggccgttgtggttggggagtgtgaagtcgaacatcggtcatacgcaggccgccgct
ggtgtggcgggtgtgatcaagatggtgatggcgatgcggcatggtgtgttgccgcgtacg
ttgcatgtggatgctccgtcgtcgcgggtggagtggtcgtcgggtgcggtggagttgttg
acggaggcggtggcctgggagcgggaggggggtccgcgtcgggcgggtgtgtcgtcgttc
gggatcagcgggaccaacgcgcacgtcatcatcgaggaacccgaggacaccgccgagcag
gccgaaacgctccccgagcccggtgaccgggtcgtgccgtgggtggtgtcggcggccacg
ccggaggcgttgcgcaggcaggccgcgcggctgcgggacgccctcggccaggaccccgag
gcgggccccgacgccgtcgcccacgccctcgccaccacccgggccgccctcgaccaccgt
gccgtcgtcgtcggcgccgaccgcgccgcgctcctcgccggcctcgactccctcgcccag
ggtgcgaccaccccggacgtgcgcaccggccaggcccgccgtcccgggaagaccgccttc
gtcttctcggggcaggggagtcagcgggtggggatggggcgtgggttgtacgaggcgttc
ccggtgttcgcggcggcgttcgacgaggtgtgtgcggggttcgaggggctcgtcgacgtc
ccggtgcgggatgttgtgttcggtgatgacgccgaggtgttggatcggacgcggtccacg
cagccggcgttgttcgcggtacaggtggcgttgttccggttggtgtcgtcgtggggtctg
gtgccggatgcggtgatcgggcattcggtgggtgaggtggcggcggcgttcgtcgcgggt
gtgtggtcgttgccggatgcgtgtcggttggttgcggcgcgtggtcggttgatggatgcg
gcgcgctcgggtggggcgatggccgcggtgcagggtccggagtccgaggtgcgttccgcg
ttggtggcgggggtggaggtggccgcggtcaacgggccggaggcgacggtggtctcgggt
gaccgggaggcggtcgaggcgctggtcgcggcgtggaaggggcggggtcgtcgggcgtcg
ttgctgcgggtgagccacgcgttccattcggcgcacatggacggggtgttggaggagttc
cgttcggttgtcggggggttggggtatgcggagccttcggtgccggtggtctccaacgtc
accggtgaggtcgccgggcccggggtgctgacgtcgccggagtactgggtgcggcacatc
cgtgaggccgtgcgcttcgccgacgggatacgcgccctcaacgaccagggcgtcaccacg
ttcttcgaggtgggcttcgacgccacgctgaccccggcggtggccgcctcggcgccggac
gcggggacggccgccatcgcgctggtgcgccgggacgagcccgagcccgtctccctgctg
accgcgctcgccgacggctacgtacgcggggccggcgtcgactggccggcggtgctgggc
cccggacggcgccgcccggtcgagctgcccacgtacccgttcgccggggaacgctactgg
ctcgcgccctccgcgccgggcggcgacgccaccacgctgggcctggacgacaccggtgag
cacccgctgctcggtgccgccgtctccgccgccgacggtgacagcctgctgctcaccgcg
cggttgtcgctgcgcacccatccgtggctggccgaccacacggtggccggggccgtgctg
ctgcccggcaccgccttcgtggagctggccctccaggccgcccgccgggccggctgcgac
gaggtggaggagctgaccctggaagccccgctggtggtgccggaaaccggcgccgtacgg
ctccaggtggcggtcggcgccccggacgcggccggacgccgcccggtgaccgtccactcc
cgtccccagggcgcccccgacgacccgccgtggacccggcacgccaccggtgccctcgcc
cccgccggacccgcgcccgccgccgaggccccggccgcctggccgcccgccggtgccgta
ccggtggacctcaccgacgcctacccgcgcctggccggactcggctacgcctacgggccg
ctcttccaggggctgaccgcgctgtggcgggacggtgccgggctctgcgccgaggtgcgg
ctgccggaggcggcggcgccggacgcggaacggtacgccctgcaccccgcgctcctcgac
gcggcgctgcacgccctcgtcctcgacccggccgaccaggcggccaccaggctgccgttc
gccttcaccggggtcagggtgcacgccgtcggcgccaccgcgctgcgggtgcggctgacc
ccggccggcggctcgcacaccgcgcggctcaccctcaccgacggcgccggccagccggtg
gcctcgatcgcctcgctggcgctgcgcccggtcgatccggccgcgctcgccgccgcgcgc
cgcgccggccgcgcgctgtacgcggtggagtgggtcccggcgcccccgtccgacggcacg
acggcgccggagctgacgttcatcgaacccgtcacggccaccggtgacgtcctcgccgac
acccactgctcggtgccggccgcccacggtgcgctgcgcgcgtggctggccggcgacccc
gccccgggggcccggctcgccgtggtcacccgcggcgccctggccgacggccccggggca
ccggccgccgccgcggtgtggggcctggtgcgttccgcgcagagcgagcacccggaccgc
ttcgtgctggtcgacatggcggacgacaccgaggtgccgcacgacctggtggccgccgcg
gtggccgccggggagagccaactcgtggtgcgcgagggggcgttgtccgtcccccggctc
atccggctccccgccgccgacgaccccgacgcgcccgcgctcgaccccgacggcaccgtg
ctgatcaccggcggcaccggcaccctcggcgcgctggtcgcccgccatctggtgacccgg
cacggggtacgccacctgctgctggtgggacgacgtggccgccaggcccccggggcgtcc
caactcgccgacgagctgcgggcgttgggcgcctccgtcgaggtggccgcgcgcgacacc
gccgaccgggacgcggtggccgcgctgctcgcctcggtccccgccggccgtccgctgacc
gccgtggtccacgcggccggggtgctcgacgacggcacgctggagtcgctgacgcccgaa
cggctggccggggtgatgcgtcccaaggcggacgccgcctggcacctgcacgagctgacc
cggggggcggacctggcggccttcgtgctcttctcctcggtggccggcacgctcggcacc
gccggccaggccaactacgccgccgccaacgccttcctcgacgcgctcgcccggcaccgc
cgcgccctcgggctcccggccacctcggtggcgtggggtctgtgggccgaggccagcggg
atgaccggggggctcggcgacgccgaccaggcccggctgcgccgcgcgggcgtcgccgcc
atgccgaccgagcagggcctcgccgccttcgacgcggccctcgccggaaccggccggccc
gacccggtggcggcccgcctcgacccggcggggctgcgcgcgggcgccgggaaccgtccg
ctgccggtgctcttccgcaccctgttccccgccgccacgcagcgccgcgcggccgacgtg
cccaccgccggatcctgggccgaccggatccgcgccctgcccgccgccgaacgcgacgcc
gccctgctctccctggtccgcgcccaggtggccaccgtcctcggccacgcccgcgccgaa
gccgtccccgccgaccgggtcttcaacgacctcggcttcgactcgctgaccgccgtcgaa
ctacgcaaccggctcgccgagaccaccggcctgcgactgcccccctccctcctcttcgac
catccgacgccgtcggctctggcgggtttcctgcggggtgaggtgacgggtgcggtggag
gcggccgaggccgttgtggtggcttcggtggacgagccgatcgcgatcgtggggatgggc
tgccgtttcccgggtgacgtctcctcacccgaggagttgtggcggctggtggccgagggg
cgggacgcgatctcggggttcccggagaaccgtgggtgggatctggaggggttgtacgat
ccggatccgcagcggcaggggacgtcgtacacgcggcatggtggtttcctgcatgacgcg
gaccggttcgacgcggagttcttcggtatctccccgcgtgaggcgttggcgaccgatccg
cagcagcggttgctgctggagacggcgtgggaggcgatcgagcgggccgggatcgacccg
accacgctccgaggctcacgtaccggtgtcttcgccggcgtgatgtacaacgactacggg
tcgcggctccagccggcgccggccgggttcgaggggttcctgctggccggcaacaccggc
agcgtggcctccggccgggtcgcgtacaccctcggcctggagggtccggcggtgagtgtg
gacacggcgtgctcgtcgtcgctggtggcgatgcacctggcggcgcaggcgctacggcag
ggcgagtgcaccctggcgctcgccggtggcgtggccgtgatgtccacacccaacacgttc
atcgagttcagcaggcagcgcgggctggcggcggacggccgctgcaaggcgttctccgac
gacgccgacggcaccggctggggcgagggcgccggcttcgtcctgctcgaacggctctcc
gacgcccgccgcaacggccacccggtgctcgccgtcatccggggcagcgcggtcaaccag
gacggcgcctccaacgggctcaccgcgcccaacggcccctcccagcaacgcgtcatccgg
caggccctggccgccgccgggctgaccgaggccgacgtggacgccgtcgaggcgcacggc
accggcacccgcctcggcgaccccatcgaggcccaggcgctgctggccacctacggccgc
caccacgaccccgagcggccgttgtggctgggcagcatcaagtccaacatcggccacacc
caggccgccgcgggcgtggccggcgtcatcaagatgacgatggcgatgcggcacggtgtg
ctgccgcgcacgctgcacgccgacaccccctcgtcccgggtggactggtcctccggcgcg
gtcgcgctgctcaccgaaccggtgccgtggcagcccggtacccgtccccgccgcgccgcc
gtctcctcgttcggcatcagcggcaccaacgcccacctcatcctggaggaaccggccgag
gaacccgccgagcggcccgcggccaaggccaccggccccgtcccgctggtgctgacggcc
cgcggtgaacggccgctgcgccaactgggcgagcgactgcgggaggtgctggccgaggac
tccggcgccgacccggccgccgtcggccgcgcgctcctcaccggccggagcgtcttcgac
caccgcgcggtcgtcctcaccgacgacaccaccggtcacctcgacgccctcgctgcgctc
gccacgggacgcccccacccggccctcgtcaccggcacggcccccgcgaccggcggcggc
accgtcttcgtcttccccggccagggctcgcagtggaccggcatggcgctcgaactcctc
gacgcctccgaggcgttccatgagcggatgcggcaatgcgccgacgcgctcgccgagttc
accgactgggacctgttcgaggtgctgcgcggcgcccccggagcgcccgggtacgaccgg
gtggacgtggtgcagccggtgctcttcgcggtgatggtgtcgctggccgcgctgtgggag
tcggccggggtccggccggacgccgtggtgggccactcccagggcgagatcgccgccgcc
tgcgtggccggggcgctcacgctgcgcgacgccgcccgggtggtcgcgctgcgcagccgg
gcgctggccgaactggccggcaccggcggcatggtctcggtgccgctccccgccgaggac
gtcgaacggcgcatccggcgctggaacggccgcctcgccgtggccgccgtcaacagcccc
ggctccgccgtggtggccggcgaccccgaggcgctggacgaactcctcgccgcctgcgcc
gcaggcggggtacgggcccgccggatcccggtcgactacgcctcgcactcaccgcacgtc
gaggcgatccgcgaccgcctgctggacctgctggccccggtggcaccccgcccggccgac
gtcccgttctgctccgccgtcaccggcgccgtcctcgacaccaccgtcctcgacgccgcc
tactggtaccgcaacctgcggcaaccggtgcgcttcgacaccgccacccgcgccctgctg
gactccggccaccgtaccttcgtcgaggtcagcgcccacccggtgctcaccatggcggtg
caggacaccttcgccgcccaccccgacccgaaggtgcccgaggaggccaccgcgctgggc
acgctgcgccgcgacgacggcggcccggaccgcttccacgcctcggccgccgaggggtac
gtatgcggcctgccggtcgactgggcccggctcaccggcgcgaccgcccccggccgccac
gtcgacctgcccacctacccgttccagcacgagtcctactggctggagccggccccgcgc
accggcgacatggccgcggcggggctgaccaccgccggccacccgctgctcggcgccgcc
gtcgacctcggcgacggccacggcaccgtcttcaccggccgcctcgccacccgcacccac
ccctggctcgccgaccacgccgtggccggcaccgtgctgctgcccggcaccgccttcgtc
gaactcgccctgcacgccgcccgccaggccggctgcgaccgcctcgacgacctcaccgtc
accgcgccgctggtgttcccggacggggccgcggtacgcctgcggatcaccgtggacgga
cccggcccggacggccggcgccacctgaccgtccactcccgccccgacgacgacaccccg
gacgccccctggacccggcacgccaccggcgtcctcgcctccggacccgcgcccgccgcc
gaggggaccccggccgcctggccgccccccggcgccgtcccggtggacctcaccgacgcc
tacccccggctcgccgcccgcggctacgcgtacggccccgccttccaagggctgcgcgcc
gcctggcggaccgacggcgaggtgtacgccgaggtgacggcggccaccggcgtcgacggc
tacgggctccaccccgccctgctcgacgccgcgctccacccggtggtgctcggcgccctc
ggcgacctggacgacgacgtgctgccgttctcctggagcggggtgacgctgcacgccgtg
ggcgccaccacgctgtgggtacggctgcgtgccgccggatccggcaccgtcgccgtcgac
gtggccgacgccaccggcgccccggtcgcccgcgtcgagtcgctggcgctgcgcccgctg
gaccgcgccgcgctgaacgagggcgcccggccgcggctgccgctgctccgtctcgcctgg
gaggacgcccggctcggcgccccgggagcggaccgccccgacctgctgacggccaccccg
gacggcggcgacccggcgcgggcggcgcgcacggcgaccgccgaggtgctggcggcgctg
cgggaacgggtggccgaccccgacgccgcaccgctggccgtggtcacccgccgcgcggtc
gtcctccccggcgacggccacgcccccgacccggccgccgccgcggtgtggggactggtg
cgttccgcgcagagcgagcaccccggccgcttcctgctggtggacaccgccgacgacacc
gagccggcgcacgacgcgctcgccgccgccctggccgccggagaaccccaactcgccctg
cgcggcggcacgttcaccgtcccccggctcacccggctccccggcgccgacgaccccgac
gcgcccgccctcgaccccgacggcaccgtgctgatcaccggcggcaccggcacgctcggc
cggctgatcgcccgccacctggtcacccggtacggggtacggcggctgctgctgctcagc
cgccgtggcgccgaggcgcccggggccgccggactcgtcgcggaactggccgcgtcgggc
gccgaagccgtggtcgaggcgtgcgacaccgccgaccgcgacgccctcgccggggtcctc
gcccggatcccggccggccacccgctgaccgccgtgatccacaccgccggcgtcctcgac
gacgccaccctcgaagcgctcacccccgaacgcctcgcgaccgtcctgcgccccaaggcg
gacgccgcctggcacctgcacgaactcacccgagacgcggacctggcggccttcgtcctc
ttctcctccgccgccggggtcctcggcaccgcgggccagggcaactacgcggcggccaac
gccttcctggacgccctcgccgcgctgcgccacgcccaggggctccccgccacctcgatg
gcgtgggggctgtgggccgaggccagcggcatgaccggcgcgctcaccggcgccgaccag
gcccggctcggccgcgccggcatcgccccgctcaccgaggaacagggcctcgccctcttc
gacgccgcgctcgccgccccggaaccgctcaccgtcccggcccggctcgacaccgccgcc
ctggcccgcgccaccggcccggtccccgccgtgctccgcgccctggtacgggtaccggcg
ctgcccaccgcgaacggcgccggcacccccgccgccgcgaccgggctcgccggacgcctg
cgcgacctgtccgaggacgagcggcgccgcctgctgcgcgacctggtcagcggccaggtg
gcgaccgtcctcggccacgccgacccggactccgtaccggccgaccgccccttcaccgag
ctgggcttcgactcgctgatcgcggtcgagctgcgcaaccggctcggcgaggccaccgga
ctgcggctgcccgcctcgctggtcttcgaccacccgacggtggcggcgctcaccgccttc
gtgcacggggagctgacgggcgcggcaccggccgccgaggccgttccggtggtgtcggcg
gtggacgagccgatcgccatcgtgggcatcggctgccgcttccccggcgacgtctcctcg
cccgaggagctgtggcgcctggtggccgagggacacgacgccgtctccgacttccccgag
gaccgcgactgggacctggacgccctatgccaccccgaccccgaccaccacggcaccttc
tacgcccgccacggcggcttcctgcatgacgccgcccgcttcgacgcggagttcttcggt
atctcgccgcgtgaggcgttggcgaccgatccgcagcagcggttgttgctggagacggcg
tgggaggcggtcgagcgggccgggatcgacccgacgacgctccgaggctcccgtaccggt
gtcttcgccggagtgatgtacaacgactacggctcccgggtcaccgacccgccgaaggac
ctggagggctacctcgtcaacggcagctccggcagcgtggcctcgggccgggtcgcgtac
accctcggcctggaggggccggcggtgagtgtggacaccgcgtgttcgtcgtcgctggtg
gcgatgcacctggcggcgcaggcgctacggcagggtgaatgcagcctggcgctcgccggt
ggtgtcaccgtgatgtccaccccgacgaccttcatcgagttcagcaggcagcgcgggctg
tcggccgacggccgctgcaaggcgttcgccgagagcgccgacggcaccggcttctccgag
ggcgccggactgctgctgttggaacggttgtcggacgcgcggcgtaacggtcatcgggtg
ctcgcggtgatccgggggagtgcggtcaatcaggatggtgcgtccaacgggttgacggcg
cccaatggtccgtcgcagcagcgggtgatccggcaggcgttggcggcggccgggttggac
gcggttgatgtggatgcggtggaggcgcatggtacggggacgcgtcttggtgatccgatc
gaggctcaggcgttgttggctgcgtatggccaggggcgtgggcggccgttgtggttgggg
agtgtgaagtcgaacatcggtcatacgcaggccgccgctggtgtggcgggtgtgatcaag
atggtgatggcgatgcggcatggtgtgttgccgcgtacgttgcatgtggatgctccgtcg
tcgcgggtggagtggtcgtcgggtgcggtggagttgttgacggaggcggtggcctgggag
cgggaggggggtccgcgtcgggcgggtgtgtcgtcgttcgggatcagcgggaccaacgcg
cacgtcatcatcgaggaacccgaggacaccccggtggccgtcgtcggtacggcggaggag
cccgaggcgccggtgatgtggacggtgtccgcgcccaccgaggccgggctgcgcgcccag
gccgcccggctcgcggaacacgccgaggcccaccccgacaccccggtcaccgccaccggc
ctcgccctggccaccacccgtaccctcttcgcccatcgcggcgccgtcgtcggacgcaac
cacaaggaactgaccgacgccctgcgcgccctcgccgaaggccgcaccctcacccacgcc
gtccacggcaccgccgccgacacccggctcgccttcgtcttctcggggcaggggagtcag
cgggtggggatggggcgtgggttgtacgaggcgttcccggtgttcgcggcggcgttcgac
gaggtgtgtgcggggtttgacgggcttgttgatctccccgtgcgggatgtggtcttcggc
gcggatgccgaggtgttggatcggacgcggtccacgcagccggcgttgttcgcggtgcag
gtggcgttgttccggttggtgtcgtcgtggggtctggtgccggatgcggtggtggggcat
tcggtgggtgaggtggcggcggcgttcgtcgcgggtgtgtggtcgttgccggatgcgtgt
cggttggttgcggcgcgtgggcggttgatggatgcggcgcgctcgggtggggcgatggcc
gcggtgcagggtccggagtccgaggtgcgttccgcgttggtggcgggggtggaggtggcc
gcggtcaacgggccggaggcgacggtggtctcgggtgaccgggaggcggtcgaggcgctg
gtcgcggcgtggaaggggcggggtcgtcgggcgtcgttgctgcgggtgagccacgccttt
cattcggcgcacatggacggggtgttggaggagttccgttcggttgtcggggggttgggg
tatgcggagccttcggtgccggtggtctccaacgtcaccggtgaggtcgccgggcccggg
gtgctgacgtcgccggagtactgggtgcggcacatccgtgaggccgtgcgcttcgccgac
gggatacgcgccctccacgaccagggcatcaccacctacctggagctgtccgggcacccc
gtgctcgcccacgacatcgggaacacgctccaggaggcggcgcccggcggacgcaccacg
gtgatcggtgcccggccgaccccggacggcgtgatgaccgcgctcgcccaggcccacgtg
gccggcgtcgcgttcgaccgcgccgcgctccacccggccggtacggtcccggcggagctg
cccacgtacgcgttcggcggccggcgttactggctggcggccacgcccgccgccacgccg
acggccccggcggcaccggaggacggcggacacccgctgctcggcccggccaccgagctg
gccggcggcggcaccgtgcacaccgcacggctctcccggcggacccaccccgggctcggc
gacgcgccgccggccaccgggacgctgctgccgccggacgcggtgcccctcgtcctcgtc
cggcgcgaaccgctgcggctgcccgccgagggcgccctcgacgtccagctcaccctcggc
gaaccggacgcgggcggccaccgcccggtgaccgtccactcccgcccggcaccggcgaac
ggcgcgcgctggacgctccacgccgagggcaccctcgccgcgcacccggccccggccgac
ccggcacccgccctccaccaggtggactgggtgcgcgtcccctccgcccgaaccggccaa
tccgccgaatccgccgaatccgtcgaggagttcacctaccgcccggccgacccggccgcc
ctccacgacctgctggaacgggtacgacgccacctcgccgacggtcgcgcccggctcgcc
gtggtcaccgaaggcgccgtcgcggtgggcggcgaacccgtcgccgacccggccgccgcc
acggcgtgggggctggtacgggccgtgcagagcgaacaccccggacgcctggtgctgctc
gacaccgacgccgcggcggcctcccgggcggccgtggcggacgccctggccaccggcgaa
ccccagctcgcgctgcgtgacggcaccgtccacgcgccccggctggtccgcgccccggcg
gcggccggcaccccggcggcgttgcgccccgacggcaccgtgctgatcaccggcggcacc
ggcgccctcggcgcgctggtcgcccgccacctggtggcccggcacggggcacgccacctg
ctgctggtgggacgacgcggaccccaggcccccggggcgtcccaactcgccgacgagctg
cgggtgttgggcgcttccgtcgaggtggccgcgtgcgacaccgccgaccgtgacgcggtg
gccgcgctgctcgcctcggtccccgccgaccgtccgctgaccgccgtggtccacgccgcc
ggggtcctcgacgacgccaccgtggaggcgctgacgcccgaacgcctcgacgccgtactg
cggcccaaggcggacgcggcccggcacctgcacgagctgacccgggaggcggaccttgcg
gccttcgtgctcttctcgtccctggccggggtggtcggcaacgcgggccaggccaactac
gccgccgccaacgcctacctcgacgccctcgcgcagcaccgggccgccgaggggctgccc
gggctctccctgtcgtgggggctgtggcacggcgacgccgaggggatcggcatggccgcc
acgctgagcggcgccgacgcggaacgcatgggccgttccggggtggcgccgatggccgcc
gaggaggcgttggcgttgttcgacgccgcgctggcgcacgggcgagcccatctggtgccg
gccgcgttcgacggcgcggcgctggcggcccgggccgccgcggggacgctgccgccgctg
ctcaccggcgtggtgccgccgacggccgagcccgccgggtccgccccggagccggaaacc
gcaccgcgtcccgcgctggaccccgcggccctccacgacctcgtcctgaccaccgtcgcc
gacgtcctcggcttcgactcaccggaggaggtggacaccgaggaggaactggtggacctc
ggcatcgactcgctgatggcggtcgaactgcgcaaccggctcgccgaggcgaccggcgtc
cagctccccgcctcgatggtctacgacttccccacggtcgacgcgctggccgaacggctt
gcggaaggcaccggtgacccggccgccggctga

DBGET integrated database retrieval system