KEGG   Streptomyces cattleya NRRL 8057 = DSM 46488: SCATT_40980Help
Entry
SCATT_40980       CDS       T02095                                 

Definition
(GenBank) superoxide dismutase, Ni
  KO
K00518  nickel superoxide dismutase [EC:1.15.1.1]
Organism
scy  Streptomyces cattleya NRRL 8057 = DSM 46488
Brite
Enzymes [BR:scy01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     SCATT_40980
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Ni BtrH_N DUF2254 HSR
Motif
Other DBs
NCBI-ProteinID: AEW96469
UniProt: F8JPB6
LinkDB All DBs
Position
complement(4395990..4396385)
Genome map
AA seq 131 aa AA seqDB search
MFSRLFAPKVKVSAHCDLPCGVYDPAQARIEAESVKAIQEKYQANEDSDFRTRAVVIKEQ
RAELAKHHVSVLWSDYFKAPHFEKYPQLHQLVNDALKALSAAKGSNDPATGQKALDLIAE
IDKIFWETKKA
NT seq 396 nt NT seq  +upstreamnt  +downstreamnt
atgttctctcgcctgttcgcgcccaaggtcaaggtcagcgcccactgcgacctgccgtgc
ggcgtctacgacccggcccaggcccgtatcgaggccgagtccgtcaaggccatccaggag
aagtaccaggccaacgaggactccgacttccgcacccgcgcggtggtcatcaaggagcag
cgggccgagctggccaagcaccacgtctcggtgctgtggagcgactacttcaaggctccg
cacttcgagaagtacccgcagctgcaccagctggtcaacgacgccctcaaggccctcagc
gccgccaagggctccaacgacccggcgaccggccagaaggcgctcgacctgatcgccgag
atcgacaagatcttctgggagaccaagaaggcctga

DBGET integrated database retrieval system