KEGG   Streptomyces cattleya NRRL 8057 = DSM 46488: SCATT_44670Help
Entry
SCATT_44670       CDS       T02095                                 

Definition
(GenBank) 4-aminobutyrate aminotransferase
  KO
K07250  4-aminobutyrate aminotransferase / (S)-3-amino-2-methylpropionate transaminase [EC:2.6.1.19 2.6.1.22]
Organism
scy  Streptomyces cattleya NRRL 8057 = DSM 46488
Pathway
scy00250  Alanine, aspartate and glutamate metabolism
scy00280  Valine, leucine and isoleucine degradation
scy00410  beta-Alanine metabolism
scy00640  Propanoate metabolism
scy00650  Butanoate metabolism
scy01100  Metabolic pathways
scy01120  Microbial metabolism in diverse environments
Module
scy_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:scy00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    SCATT_44670
   00650 Butanoate metabolism
    SCATT_44670
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    SCATT_44670
   00280 Valine, leucine and isoleucine degradation
    SCATT_44670
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    SCATT_44670
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:scy01007]
    SCATT_44670
Enzymes [BR:scy01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     SCATT_44670
    2.6.1.22  (S)-3-amino-2-methylpropionate transaminase
     SCATT_44670
Amino acid related enzymes [BR:scy01007]
 Aminotransferase (transaminase)
  Class III
   SCATT_44670
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Aminotran_1_2
Motif
Other DBs
NCBI-ProteinID: AEW96838
UniProt: F8JQM8
LinkDB All DBs
Position
complement(4799110..4800459)
Genome map
AA seq 449 aa AA seqDB search
MTEVSGGPALPQERRLVTSIPGPKSQELLARKTAAVADGVGTTLPVFVTRAGGGVLEDVD
GNSLIDFGSGIAVTSVGNSAEAVVRRATEQLAAFTHTCFMVTPYEGYVEVAERLAELTPG
DHAKKSALFNSGAEAVENAVKIARAYTKRTAVVVFDHGYHGRTNLTMALTAKNMPYKHGF
GPFAPEVYRVPLAYPFRWPTGAEKCADEAAAQAIDVVSKQIGAENVAAIIIEPIQGEGGF
IEPAKGFLPAIARFARENGIVFVADEIQTGFCRTGQWFACEDEGVVPDLITTAKGIAGGL
PLAAVTGRAEIMDAAHAGGLGGTYGGNPVACAAALGAIETMKELDLNAKAKRIEEVMKGR
LTALQEKFAVIGEVRGRGAMIAVELVKPGTKEPDAAATAAVAKFCHTNGVVVLTCGTYGN
VLRFLPPLVIGEDLLTEGLDVIENAFAAL
NT seq 1350 nt NT seq  +upstreamnt  +downstreamnt
atgaccgaagtgtccggtggccccgcgctgccccaggaacgtcgtctcgtcacctcgatc
cccggcccgaagtcgcaggagctgctggcgcgcaagacggccgcggtcgcggacggcgtg
ggcacgaccctgccggtcttcgtgacccgggcgggcggcggcgtgctggaggacgtggac
ggcaactcgctgatcgacttcggctccggcatcgcggtcacctcggtgggcaacagcgcc
gaggccgtggtccgccgggcgacggagcagctggcggcgttcacccacacgtgtttcatg
gtgaccccgtacgagggctacgtggaggtcgccgagcggctggccgagctgaccccgggc
gaccacgccaagaagtcggcgctgttcaactccggcgcggaggcggtggagaacgcggtc
aagatcgcccgggcgtacaccaagcgcaccgcggtcgtcgtcttcgaccacggctaccac
ggccgcaccaacctgacgatggcgctgaccgccaagaacatgccgtacaagcacggcttc
gggccgttcgcgcccgaggtgtaccgggtaccgctggcgtacccgttccgctggcccacc
ggggcggagaagtgcgccgacgaggccgcggcgcaggcgatcgacgtggtctccaagcag
atcggcgcggagaacgtggccgcgatcatcatcgagccgatccagggtgagggcggcttc
atcgagccggccaagggcttcctgccggcgatcgcccggttcgcccgggagaacggcatc
gtcttcgtcgccgacgagatccagaccggcttctgccgtaccggccagtggttcgcctgt
gaggacgagggcgtcgtcccggacctgatcaccaccgccaagggcatcgcgggcgggctg
ccgctggcggcggtcaccgggcgcgcggagatcatggacgcggcccacgccggcggcctg
ggcggcacctacggcggcaacccggtggcctgcgccgccgcgctgggcgccatcgagacc
atgaaggagctcgacctcaacgcgaaggcgaagcggatcgaggaggtcatgaagggccgc
ctgaccgcgctccaggagaagttcgcggtgatcggcgaggtccgcggccggggcgcgatg
atcgcggtggagctggtcaagccgggcaccaaggagccggacgccgccgcgaccgccgcc
gtggccaagttctgccacaccaacggcgtggtggtgctcacctgcggcacctacggcaac
gtgctgcgtttcctgcccccgctggtgatcggcgaggacctgctcaccgagggcctggac
gtcatcgagaacgccttcgccgcgctgtga

DBGET integrated database retrieval system