KEGG   Streptomyces cattleya NRRL 8057 = DSM 46488: SCATT_54090Help
Entry
SCATT_54090       CDS       T02095                                 

Definition
(GenBank) putative aldehyde dehydrogenase
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
scy  Streptomyces cattleya NRRL 8057 = DSM 46488
Pathway
scy00010  Glycolysis / Gluconeogenesis
scy00053  Ascorbate and aldarate metabolism
scy00071  Fatty acid degradation
scy00280  Valine, leucine and isoleucine degradation
scy00310  Lysine degradation
scy00330  Arginine and proline metabolism
scy00340  Histidine metabolism
scy00380  Tryptophan metabolism
scy00410  beta-Alanine metabolism
scy00561  Glycerolipid metabolism
scy00620  Pyruvate metabolism
scy00625  Chloroalkane and chloroalkene degradation
scy00903  Limonene and pinene degradation
scy01100  Metabolic pathways
scy01110  Biosynthesis of secondary metabolites
scy01120  Microbial metabolism in diverse environments
scy01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:scy00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SCATT_54090
   00053 Ascorbate and aldarate metabolism
    SCATT_54090
   00620 Pyruvate metabolism
    SCATT_54090
  09103 Lipid metabolism
   00071 Fatty acid degradation
    SCATT_54090
   00561 Glycerolipid metabolism
    SCATT_54090
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    SCATT_54090
   00310 Lysine degradation
    SCATT_54090
   00330 Arginine and proline metabolism
    SCATT_54090
   00340 Histidine metabolism
    SCATT_54090
   00380 Tryptophan metabolism
    SCATT_54090
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    SCATT_54090
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    SCATT_54090
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    SCATT_54090
Enzymes [BR:scy01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     SCATT_54090
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: AEW97780
UniProt: F8JPL1
LinkDB All DBs
Position
5823678..5825135
Genome map
AA seq 485 aa AA seqDB search
MSYSSELALQYIDGQWKSGSGSWEIIDFNPYNGEKIAAITVATVDEVDQAYRAAERAQRE
WARVNPYTRRLVFERALRILEDREAEITEAIIEELGGTRVKAGFEIGLSKDMLREAMQLA
LRAEGRILPSPVDGKENRLYRLPVGVVGVISPFNFPLFLSLKSVAPALALGNGVVLKPHQ
NTPIVGGTLIAKLFEEAGLPPGLLNVVVTDIAEIGDALIEHPVPKVISFTGSDKVGRHVA
QVAASHFKRTVLELGGNSALIVLDDADLDYAVDAAVFSRFVHQGQVCMAANRVLVDRSVE
REFSERFVAKVRTLKVGDPQDPATHIGPLINATQAGAVEAQVAGALEAGATALLRGRTEG
TLMEPSVLTGVPRDAAILGTEIFGPVVLLIPFDGEDEAVRIANDSPFGLSGAVHTADVER
GVRVAQRIETGMIHVNDGTVADEPLVAFGGEKHSGVGRLNGESTVEAFTTLKWISIQHGR
SVFPF
NT seq 1458 nt NT seq  +upstreamnt  +downstreamnt
atgtcctattcttccgaattggcgcttcaatacatcgacggccagtggaagtccggcagc
ggctcctgggagatcatcgatttcaacccctacaacggggagaaaatcgcggccataacg
gtggccacggtcgacgaggtggaccaggcgtaccgggcggccgagcgggcccagcgggaa
tgggcccgggtcaacccgtacacccggcggctggtcttcgagcgggcgctgcgcatcctg
gaggaccgggaggcggagatcaccgaggccatcatcgaggagctgggcggcacccgggtc
aaggccggcttcgagatcgggctgtcgaaggacatgctccgggaggcgatgcagctcgcg
ctgcgcgccgagggacgcatcctgccctccccggtggacggcaaggagaaccggctctac
cggctgccggtcggcgtggtcggcgtcatcagccccttcaacttcccgctcttcctctcc
ctgaagtcggtggccccggcgctggcgctgggcaacggcgtggtgctcaagccgcaccag
aacaccccgatcgtcggcggcaccctgatcgccaagctcttcgaggaggccgggctgccg
ccggggctgctcaacgtggtggtcaccgacatcgccgagatcggcgacgcgctcatcgag
cacccggtgcccaaggtgatctccttcaccggctcggacaaggtgggccgccacgtcgcc
caggtcgcggccagccacttcaagcgcaccgtgctcgaactcggcggcaacagcgcgctg
atcgtgctcgacgacgccgacctcgactacgcggtggacgccgccgtcttcagccgcttc
gtccaccagggccaggtgtgcatggcggccaaccgggtgctggtcgaccggtcggtggaa
cgggagttcagcgagcgattcgtcgccaaggtacgcaccctcaaggtcggcgacccgcag
gacccggcgacccacatcggcccgctgatcaacgccacccaggccggtgccgtcgaggcc
caggtggccggcgccctggaggccggggccaccgcgctgctgcgcgggcgtaccgagggc
accttgatggagccctcggtgctgaccggggtgccgcgggacgcggcgatcctcggcacc
gagatcttcggcccggtggtgctgctgatccccttcgacggcgaggacgaggcggtccgc
atcgccaacgactccccgttcggcctcagcggcgccgtccacaccgccgacgtcgagcgc
ggggtgcgcgtcgcgcagcgcatcgagaccggcatgatccacgtcaacgacggcacggtg
gccgacgaacccctcgtcgccttcggcggggagaagcactccggggtgggccgcctcaac
ggcgagtccacggtggaggcgttcaccacgctgaagtggatctccatccagcacgggcgc
agcgtcttcccgttctga

DBGET integrated database retrieval system