KEGG   Streptomyces cattleya NRRL 8057 = DSM 46488: SCATT_56870
Entry
SCATT_56870       CDS       T02095                                 

Definition
(GenBank) deacetoxycephalosporin C synthase
  KO
K12744  deacetoxycephalosporin-C synthase [EC:1.14.20.1]
Organism
scy  Streptomyces cattleya NRRL 8057 = DSM 46488
Pathway
scy00311  Penicillin and cephalosporin biosynthesis
scy01100  Metabolic pathways
scy01110  Biosynthesis of secondary metabolites
Module
scy_M00673  Cephamycin C biosynthesis, aminoadipate + cycteine + valine => cephamycin C
Brite
KEGG Orthology (KO) [BR:scy00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00311 Penicillin and cephalosporin biosynthesis
    SCATT_56870
Enzymes [BR:scy01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.20  With 2-oxoglutarate as one donor, and the other dehydrogenated
    1.14.20.1  deacetoxycephalosporin-C synthase
     SCATT_56870
SSDB
Motif
Pfam: 2OG-FeII_Oxy DIOX_N
Other DBs
NCBI-ProteinID: AEW98058
UniProt: F8JTW8
LinkDB
Position
6124826..6125761
AA seq 311 aa
MDTTVPTFSLKDLQHGARQEEFRTALKDKGVFYLTDCGLTDADQQAAKDIAVDFFEHGTE
ARKRAVTSTVPTIRRGFTGLESESTARITNTGSYSDYSMCYSMGLTGNLFPTPEFESVWT
GYFHRMYDTTKEVARQVLKTTGTEPAGGVENFVDCEPLLRFRYFPEVPEDRSAEEEPLRM
APHYDLSTVTVIQQTPCPNGFVSLQSEVGGAFVDLPAKADAVLVFCGAVATLVTGGQVKA
PRHHVAAPGRDRIAGSSRTSSVFFLRPDSDFAFSVPLARRCGFDISLDGETATFKDWIEG
NYVNIRTTAQA
NT seq 936 nt   +upstreamnt  +downstreamnt
atggacaccaccgtgccgacgttcagcctgaaggacctccaacacggcgcacgacaggag
gagttccgcaccgccctgaaggacaagggcgtcttctacctgaccgactgcggcctgacc
gacgccgaccagcaggccgccaaggacatcgccgtcgacttcttcgaacacggcaccgag
gcccggaaacgcgccgtcaccagcaccgtccccaccatccgccgcggcttcaccgggctg
gagtcggagagcaccgcgcgcatcaccaacaccggcagctactccgactactcgatgtgc
tactcgatggggcttaccggcaacctcttccccacccccgagttcgaaagcgtgtggacc
ggctacttccaccgcatgtacgacacgaccaaggaagtggcccggcaggtgctgaagacc
accgggaccgaaccggcgggcggcgtggagaacttcgtcgactgcgaaccactgctgcgg
ttccgctacttcccggaggtccccgaagaccgcagcgccgaggaggaaccgctgcggatg
gcaccccactacgacctgtcgacggtgaccgtcatccagcagaccccgtgccccaacggc
ttcgtgagcctgcagagcgaggtcggcggcgccttcgtggacctgccggccaaggccgac
gccgtcctcgtcttctgcggggccgtggcgaccctggtgaccggcggccaggtgaaggca
ccgaggcaccacgtcgccgcgcccggccgggaccggatcgccggcagcagccgcacgtcc
agcgtcttcttcctgcgccccgactccgacttcgccttctccgtccccctcgccaggcgg
tgcgggttcgacatctccctcgacggcgagaccgccaccttcaaggactggatcgagggc
aactacgtcaacatccgcaccacggcccaggcatga

DBGET integrated database retrieval system