KEGG   Streptomyces cattleya NRRL 8057 = DSM 46488: SCATT_57100
Entry
SCATT_57100       CDS       T02095                                 

Definition
(GenBank) extracellular aminoglycoside phosphate phosphatase
  KO
K04342  streptomycin-6-phosphatase [EC:3.1.3.39]
Organism
scy  Streptomyces cattleya NRRL 8057 = DSM 46488
Pathway
scy00521  Streptomycin biosynthesis
scy01100  Metabolic pathways
scy01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:scy00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    SCATT_57100
Enzymes [BR:scy01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.39  streptomycin-6-phosphatase
     SCATT_57100
SSDB
Motif
Pfam: Alk_phosphatase Metalloenzyme
Other DBs
NCBI-ProteinID: AEW98081
UniProt: F8JTY6
LinkDB
Position
complement(6148715..6150073)
AA seq 452 aa
MPRPTRRHLTVATALIAATTAAVAVTTTAGAFDGKDRAKSAIQGGKARNVILLIGDGMGD
SEITLARDYTVGANGRLNMDAFPLTGAYTTYAVHADGTPDYVTDSAASGTGWATGVKTVN
GRVSKTPGTDKPVRTLLELAQRNGYATGDVTTAELTDATPAVLASHVTDRSCQGPADMAK
CPTDTIAAGGPGSIAEQEVGHKVDVLFGGGRQRFDQKVTDGRYKGLTVTEQARRLGYRVV
TDDASMKAAEPGRPVLGLFAPGNVPTEWTGKPAAVGGTDPQRCVTSNPGRPAATPSLADS
AAKAIRLLEAKQKHSRQGFFLQIEGASIDKQDHAADPCGQIGETAAFDKAVRVARAYAAQ
HPDTLVVTTADHGHTSQIVPLEATPPGLSATLVTNEGQQLKVNYSTNTPGRSQEHTGTQV
RIAAQGPLAYRVLGVTNQTDLFTTVREALRLR
NT seq 1359 nt   +upstreamnt  +downstreamnt
atgcccagacccacccgccgtcacctcaccgtcgccaccgcgctgatcgcggccaccacg
gccgccgtggccgtgaccaccaccgccggcgccttcgacggcaaggaccgggcgaagtcc
gcgatccagggcgggaaggcgaggaacgtcatcctgctcatcggcgacggcatgggcgac
tcggagatcaccctcgcccgggactacacggtcggcgccaacggccgcctgaacatggac
gcgttcccgctcaccggcgcgtacaccacgtacgccgtgcacgccgacggcacgccggac
tacgtcaccgactccgccgccagcggcaccggctgggccaccggcgtgaagacggtcaac
ggacgcgtctccaagacccccggcaccgacaagccggtgcgcaccctgctggagctggcc
cagcgcaacggctacgccaccggtgacgtcaccaccgccgaactcaccgacgccaccccg
gcggtgctcgcctcgcacgtgaccgaccgctcctgccagggcccggccgacatggccaag
tgccccaccgacaccatcgccgcgggcgggccgggctccatcgccgagcaggaggtcggt
cacaaggtcgacgtcctcttcggcggcggcaggcagcgcttcgaccagaaggtcaccgac
ggcaggtacaagggcctcaccgtcaccgagcaggcacgcaggctcggttaccgggtcgtc
accgacgacgcgtcgatgaaggcggccgagccggggcggccggtcctcggtctcttcgcc
cccggcaacgtgcccaccgagtggaccggcaagccggccgcggtcggcggcacggacccg
cagcggtgcgtcacctccaaccccggccgcccggcggccaccccgagcctggccgactcc
gcggcgaaggccatccgcctgctggaggccaagcagaagcactcccggcagggcttcttc
ctccagatcgagggcgcctccatcgacaagcaggaccacgccgccgacccctgcggccag
atcggcgagaccgccgccttcgacaaggcggtgcgggtcgcccgcgcctacgccgcccag
caccccgacaccctcgtcgtcaccaccgccgaccacggccacaccagccagatcgtcccg
ctggaggccaccccgcccgggctctccgccaccctcgtcaccaacgagggccagcagctg
aaggtcaactactcgaccaacaccccgggccggtcccaggagcacaccggcacccaggtc
cgcatcgccgcccagggcccgctggcctaccgcgtcctcggcgtcaccaaccagaccgac
ctgttcaccaccgtccgcgaggcgctgcggctgcgctga

DBGET integrated database retrieval system