KEGG   Streptomyces cattleya NRRL 8057 = DSM 46488: SCATT_p11640Help
Entry
SCATT_p11640      CDS       T02095                                 

Definition
(GenBank) putative glutamate decarboxylase
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
scy  Streptomyces cattleya NRRL 8057 = DSM 46488
Pathway
scy00250  Alanine, aspartate and glutamate metabolism
scy00410  beta-Alanine metabolism
scy00430  Taurine and hypotaurine metabolism
scy00650  Butanoate metabolism
scy01100  Metabolic pathways
scy01110  Biosynthesis of secondary metabolites
scy01120  Microbial metabolism in diverse environments
scy02024  Quorum sensing
Module
scy_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:scy00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    SCATT_p11640
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    SCATT_p11640
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    SCATT_p11640
   00430 Taurine and hypotaurine metabolism
    SCATT_p11640
 Cellular Processes
  Cellular community - prokaryotes
   02024 Quorum sensing
    SCATT_p11640
Enzymes [BR:scy01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     SCATT_p11640
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyridoxal_deC
Motif
Other DBs
NCBI-ProteinID: AEW99357
UniProt: F8JMG5
LinkDB All DBs
Position
pSCATT:1168546..1169988
Genome map
AA seq 480 aa AA seqDB search
MPLKHPHHQADHPGHGNRDIEVNPIFAREPLSVPRYALPSGEMEPETAYQLVHDELMLDG
NARLNLATFVSTWAEPAALRLMSECAEKNMIDKDEYPQTAELENRCVHMLARLWHAPDPR
HAVGCSTTGSSEAAMLGGLALKRRWQHRRRAEGKPADRPNLVMGVNVQICWEKFADYFEV
EPRYVPMEGDRFHLDARHAVELCDENTIGVVAVLGSTFDGSYEPVAEIAAALDDLQRRTG
LDVPVHVDGASGGMIAPFLDPDLEWDFRLPRVASINTSGHKYGLVMPGVGWALWRDADAL
PDDLVFHVNYLGGDMPTFALNFSRPGAQVVAQYYNFLRLGFDGYRRVQQTCRDVATSLAA
RIAELGPFELITDGSDIPVFAFRVRDEVDNFTVFDVSAALRERGWLVPAYTFPKNRTDLA
VLRIVVRNGFSHDLADLLLADLRRVLPRLEKQPGPYRSEEDAGGFAHGAETKNPRHPGRH
NT seq 1443 nt NT seq  +upstreamnt  +downstreamnt
atgccgctgaagcacccgcaccaccaagcggaccaccccggccacggcaaccgggacatc
gaggtcaaccccatcttcgcccgcgagccgctgagcgtcccgcgctacgcgctgccgtcc
ggcgagatggagccggagaccgcctaccaactcgtccacgacgagctgatgctggacggc
aacgcccgcctcaacctggccacgttcgtctccacctgggccgagccggccgcgctgcgg
ctgatgtccgagtgcgccgagaagaacatgatcgacaaggacgagtacccgcagaccgcg
gagctggagaaccgctgcgtccacatgctcgcccggctgtggcacgcgccggacccgcgg
cacgcggtcggctgctcgaccaccggctccagcgaggccgccatgctcggcggcctggcg
ctcaagcgccgctggcagcaccgccggcgcgcggagggcaagccggccgaccggcccaac
ctggtgatgggcgtcaacgtgcagatctgctgggagaagttcgccgactacttcgaggtc
gaaccgcgctacgtccccatggagggcgaccgcttccacctggacgcccgccacgcggtg
gagctgtgcgacgagaacaccatcggcgtcgtcgccgtcctcggctccaccttcgacggc
tcctacgaacccgtcgccgagatcgccgccgccctcgacgacctccagcggcgcaccggc
ctggacgtccccgtccacgtcgacggcgcctccggcggcatgatcgccccgttcctcgac
cccgacctggagtgggacttccggctgccccgggtcgcctcgatcaacacctccggccac
aagtacgggctggtgatgccgggcgtcggctgggcgctgtggcgggacgccgacgccctc
ccggacgacctggtgttccatgtgaactacctcggcggcgacatgccgacgttcgccctg
aacttctcccgccccggcgcccaggtggtggcccagtactacaacttcctgcggctgggg
ttcgacggctaccgccgcgtccagcagacctgccgggacgtcgccacctccctggccgcc
cggatcgccgagctgggcccgttcgagctgatcaccgacggcagcgacatcccggtcttc
gccttccgggtccgcgacgaggtcgacaacttcaccgtcttcgacgtctccgccgccctg
cgtgaacgcggctggctggtgcccgcctacaccttccccaagaaccgcaccgacctcgcc
gtgctgcgcatcgtggtgcgcaacgggttcagccacgacctcgccgacctcctcctggcc
gacctgcgccgggtgctgccccggctggagaagcaaccggggccctaccgcagcgaggag
gacgccggaggcttcgcacacggcgccgagaccaagaacccgcgccaccccggccgccat
tga

DBGET integrated database retrieval system