KEGG   Streptomyces cyaneochromogenes: EJ357_02055
Entry
EJ357_02055       CDS       T06811                                 

Definition
(GenBank) 1-epi-valienol-1,7-bisphosphate-1-adenylyltransferase
  KO
K20427  valienol-1-phosphate guanylyltransferase [EC:2.7.7.91]
Organism
scya  Streptomyces cyaneochromogenes
Pathway
scya00525  Acarbose and validamycin biosynthesis
scya01100  Metabolic pathways
scya01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:scya00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00525 Acarbose and validamycin biosynthesis
    EJ357_02055
Enzymes [BR:scya01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.91  valienol-1-phosphate guanylyltransferase
     EJ357_02055
SSDB
Motif
Pfam: NTP_transferase NTP_transf_3
Other DBs
NCBI-ProteinID: AZQ32381
UniProt: A0A3S9LZJ8
LinkDB
Position
535723..536841
AA seq 372 aa
MDDVRAVLLAGGEGRRLGRLGSGRLKPLVPFGGTSRLVDFSLANARRSGFSEVLLLSQYE
ERQLMDDLHQVWNCRDFRVHFGPYDTAYRGLPPGELPGGLPERSLPRERGTADALIRKAA
HVFGGHPSDVLVLHADHVYRFDYRDMLREHRATRAALTIAYQRVERRYVHLFGMVEFDTG
GNLVHFTEKPAEPTSDLVFAAFCIFDAARLRRYLERLDGTDWQHDISRDVIPAMLAGGER
IRGHLVRGHWEDIGTVDRYLRAHLALLSAAPTLSLGHLPLTIRPDVARRFIRGTAGVRTA
IVPSDLDNAGLVERSVVFPGARIGQDAVVRDSVLLPGAEVPADARVGSAIVLEDGSVQPV
DPYYSAEFPPTE
NT seq 1119 nt   +upstreamnt  +downstreamnt
gtggatgacgtgcgcgcggtcctgctggccggcggtgagggacggcgattgggccgtctg
ggcagcggtcggctcaaacccctggtgccgttcggagggaccagccgactggtcgacttc
agcctggccaacgcccggcgatccggcttctccgaggtgctgctgttgtcccagtacgag
gagcggcagctcatggacgatctgcatcaggtgtggaactgccgggacttccgggttcac
ttcggcccgtacgacaccgcgtaccgcgggctgcctcccggcgagctgccgggcgggctg
ccggagcggagcctgcccagggaacgcggcaccgccgacgcactcatccgcaaggccgcc
catgtgttcggcgggcacccgtccgacgtcctggtcctgcatgccgaccacgtctatcgc
ttcgactaccgggacatgctgcgtgaacatcgcgcgacccgcgctgccctgaccatcgcc
taccaacgcgtcgaacgccgctacgtgcacctcttcggcatggtcgagttcgataccggc
gggaatctcgtgcatttcacggagaaacccgccgagccgaccagtgaccttgttttcgcc
gccttctgcatcttcgacgcggcgcgcctgcggcgatatctggaaagactcgacggcact
gactggcagcacgacatcagccgggacgtgatacccgccatgctggcagggggtgagcga
atccggggccatctcgttcgcgggcactgggaggacatcggaacggtggaccggtacctc
cgagcgcacctggctctgctctccgcagcgcccacgctttcgctcggccatctgccgctc
acgatccggccggacgtcgcacggcggttcatccgtggcaccgcgggtgtacgaaccgcc
atcgtgccgtccgacctggacaacgccgggttggtcgagcgcagtgtggtcttccccggt
gcgcggatagggcaggacgccgtcgtccgggacagcgtgctgctgccgggcgccgaggta
cccgccgacgcccgagtcggttcggccatcgtcctggaggacggttccgtccaaccggtc
gacccgtattactcggctgaatttccacctaccgaataa

DBGET integrated database retrieval system