KEGG   Streptomyces sp. CFMR 7: ABE83_03950Help
Entry
ABE83_03950       CDS       T04074                                 

Definition
(GenBank) ATP-dependent DNA ligase
Organism
scz  Streptomyces sp. CFMR 7
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_C RNA_ligase
Motif
Other DBs
NCBI-ProteinID: ALC26325
UniProt: A0A0M4E163
LinkDB All DBs
Position
1039354..1040415
Genome map
AA seq 353 aa AA seqDB search
MDLPVMPPLKPMLAKSVAKIPPGMSYEAKWDGFRAIVYRDGDEVEIGSRTGKSLTRYFPD
LVDAVRENLPPRCVIDGEIVIAHEGRLDFDRLSERIHPADSRVRMLAERTPASFIAFDIL
AVDDTSLLSTPQTDRRSVLVAALSGASAPVLLAPSTKDIELAREWFDRYEGAGLDGIVAK
PPDLPYRPDTRVMYKIKHERTADVVVAGYREHKSGPVVGSLLLGLYDTGGVLQHVGVCAA
FPMKRRAELAEELAPLRCAFTDHPWGAWAEAAAHEAARLPGTQNRWTGKKDQSWVPLRPE
RVCEVAYDHMEGDRFRHTTQFRRWRPDRTPASCTYAQLEEVVSYDLAQVLAGG
NT seq 1062 nt NT seq  +upstreamnt  +downstreamnt
atggacctgccggtgatgccgcccctcaagccgatgctcgccaagtcggtggccaagatc
ccgccgggcatgagctacgaggcgaagtgggacggcttccgggcgatcgtctaccgcgac
ggtgacgaggtggagatcggcagccgtacgggcaagtccctgacccgctacttcccggac
ctggtcgacgccgtacgggagaacctgccgccgcgctgtgtgatcgacggggagatcgtc
atcgcccatgaggggcggctcgatttcgaccggctcagcgagcgcatccatccggcggac
tcccgggtgcggatgctggccgagcggaccccggcgagcttcatcgccttcgacatcctg
gcggtggacgacacctccctgctgagcaccccgcagaccgaccggcggtccgtgctggtg
gcggccctctccggcgcctccgcgcccgtgctcctcgccccgtccaccaaggacatcgag
ctggcccgggagtggttcgaccggtacgagggcgcgggactggacgggatcgtggcgaag
ccgccggacctgccgtaccggcccgacacccgggtgatgtacaagatcaagcacgagcgg
accgccgatgtcgtggtggcgggataccgggagcacaagagcggcccggtcgtcggctcg
ctgctgctcggtctgtacgacaccgggggcgtgctccagcacgtcggggtctgcgcggcc
ttcccgatgaagcggcgcgccgagctggccgaggaactggccccgctgcgctgcgcgttc
accgaccatccgtggggcgcgtgggcggaggcggcggcgcacgaggccgcccggctgccg
gggacgcagaaccgctggacggggaagaaggaccagtcgtgggtgccgctgcggccggag
cgggtctgcgaggtcgcgtacgaccacatggagggcgaccggttccgccatacgacgcag
ttccggcggtggcgcccggaccggaccccggcgagctgtacatacgcgcagttggaggag
gtcgtctcctacgacctggcgcaggtgctggcgggcggctga

DBGET integrated database retrieval system