KEGG   Streptomyces sp. CFMR 7: ABE83_05185Help
Entry
ABE83_05185       CDS       T04074                                 

Definition
(GenBank) aminotransferase class III
  KO
K00823  4-aminobutyrate aminotransferase [EC:2.6.1.19]
Organism
scz  Streptomyces sp. CFMR 7
Pathway
scz00250  Alanine, aspartate and glutamate metabolism
scz00410  beta-Alanine metabolism
scz00640  Propanoate metabolism
scz00650  Butanoate metabolism
scz01100  Metabolic pathways
scz01120  Microbial metabolism in diverse environments
Module
scz_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:scz00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    ABE83_05185
   00650 Butanoate metabolism
    ABE83_05185
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    ABE83_05185
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    ABE83_05185
Enzymes [BR:scz01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     ABE83_05185
Amino acid related enzymes [BR:scz01007]
 Aminotransferase (transaminase)
  Class III
   ABE83_05185
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Aminotran_1_2 Beta_elim_lyase
Motif
Other DBs
NCBI-ProteinID: ALC26541
UniProt: A0A0M4DEL3
LinkDB All DBs
Position
complement(1333573..1334856)
Genome map
AA seq 427 aa AA seqDB search
MSGLYERHLAVSPEWLALYYRHPIELTHGEGRYVWDADGNRYLDFFGGILTTMTAHALPE
VTKAVSEQAGRIIHSSTLYLNRPMVELAERIAHLSGIPDARVFFTTSGTEANDTALLLAT
AYRRSNQILAMRNSYHGRSFSAVSITGNHAWSPTTLSPLQTLYVHGGVRSRGPYAELSDD
RFIRACVADLEDLLGHTREAAALIAEPIQGVGGFTSPPDGLFAAFREVLDRHGVLWISDE
VQTGWGRTGEHFWGWQAHAENGPPDMLTFAKGIGNGMSIGGVVARAEVMNCLDANSISTF
GGSPVTMAAGLANLTYHLEHDLQGNARRVGGLLIERLRSVAAASDAVREVRGRGLMIGIE
LVKPGTDEADPEAAAAVLEAARAGGLLIGKGGGHNTSVLRIAPPLTLTVAEAEEGASILA
DALRAAG
NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt
gtgagcggactgtacgagcgccacctcgccgtcagccccgagtggctggccctctactac
cgccaccccatcgaactcacccacggcgagggccggtacgtctgggacgccgacggcaac
cgctacctggacttcttcggcggcatcctcaccaccatgaccgcccacgccctgcccgag
gtcaccaaggcggtctccgaacaggccgggcggatcatccactcctccaccctctacctc
aaccgcccgatggtggagctggccgagcgcatcgcccacctctccggcatccccgacgcc
cgggtcttcttcaccacctcgggcaccgaggccaacgacacggccctcctgctcgccacc
gcgtaccgccgctccaaccagatcctggcgatgcgcaacagctaccacggccgctcgttc
tcggccgtctccatcaccggcaaccacgcctggtcgcccacgacgctctccccgctccag
acgctgtacgtccacgggggcgtccggagccggggcccgtacgcggagttgagcgacgac
cggttcatccgggcctgcgtcgcggacctggaggacctgctcggccacacccgggaggcc
gcggccctcatcgcggaaccgatccagggcgtcggcggcttcacctcaccgcccgacgga
ctgttcgccgcgttccgtgaagtgctggaccggcacggggtgttgtggatctccgacgag
gtgcagaccggctggggccggaccggcgaacacttctgggggtggcaggcgcacgccgag
aacgggccgccggacatgctcaccttcgccaagggcatcggcaacggcatgtccatcggc
ggagtcgtcgcccgggccgaggtgatgaactgcctggacgccaactccatctccacgttc
ggcggttcacccgtcaccatggcggcgggtctcgccaacctcacgtaccacctggagcac
gacctccagggcaacgcccggcgcgtgggcggtctgctcatcgagcggctgcggtcggtc
gccgccgcttccgacgccgtacgcgaggtgcgcggccggggcctgatgatcggcatcgag
ctggtgaagcccggcacggacgaggcggacccggaggcggccgcggccgtcctggaggcg
gcgcgcgcgggcggtctgctcatcggcaagggcggcggccacaacaccagcgtgctgcgg
atcgccccgcccctgaccctgaccgtcgccgaggcggaggagggcgcgtcgatcctggcc
gacgccctgcgcgccgccggctga

DBGET integrated database retrieval system