KEGG   Streptomyces sp. CFMR 7: ABE83_13020Help
Entry
ABE83_13020       CDS       T04074                                 

Definition
(GenBank) sialidase
  KO
K01186  sialidase-1 [EC:3.2.1.18]
Organism
scz  Streptomyces sp. CFMR 7
Brite
KEGG Orthology (KO) [BR:scz00001]
 09100 Metabolism
  09103 Lipid metabolism
   00600 Sphingolipid metabolism
    ABE83_13020
  09107 Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    ABE83_13020
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02042 Bacterial toxins [BR:scz02042]
    ABE83_13020
Enzymes [BR:scz01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.18  exo-alpha-sialidase
     ABE83_13020
Bacterial toxins [BR:scz02042]
 Toxins that damage the extracellular matrix
  Hyaluronidases/Collagenases
   ABE83_13020
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: BNR_2 Laminin_G_3 Laminin_G_2 BNR_3 Laminin_G_1 BNR Sortilin-Vps10
Motif
Other DBs
NCBI-ProteinID: ALC27916
UniProt: A0A0M4DGU8
LinkDB All DBs
Position
3232865..3234778
Genome map
AA seq 637 aa AA seqDB search
MPLFRRGSQPAHRRTRPLTAVLALTLTATVLGAPAPPAVAAVPAAVTTPFKAGGEGYRCF
RIPALVTTPSGALLAFAEGRVATCSDIGHNDIVMRKSTDGGRSWGPLKVVVGGADEDAHG
NPAPVVDAATGRVSLLYATGPWSGTPGEPVRGPRSLRVVHSVDDGAGWAEGAPLPHLKPA
GRAWISTGPGHGIQLARGPHRGRLVVPGDYTTTGGRAGGQLYVSDDGGLTWSLGAQAEVD
RATAPAFPAELSVAETTGGGVYVNARSSARCGTENHRMATTSTDGGAAFDAPFSPVPGLD
TPPVSGSLLRLHAKELGAVRDRLLFSAPSRLGPHTLEDRRELAIRSSYDEGRTWQTAGTV
VTPGRSGYSDLAQLPSGAIGVLYESAGNIPHSDLVFTSFTEAQLDASHRELRLPRTSDTG
PNGYGNHALVHGGAQLGSRGSGRAMTFDGQDDYLRLVSCSDSLRLGAGDFTLTAWFRHTA
TTGALPIVWGYGMGSGVRQFWLRAEPGRGAVRAAIDTGTAYAEVRTTSSYNDGQWHHAVL
RRQAGRLALSVDGGQEFTAAAPAGDITPPAEFSVHIGARPDFPNQPAGVTELFRGGLDDI
RLFGRALTAQEASRVKGGALDVANEEERVRLGFSGIW
NT seq 1914 nt NT seq  +upstreamnt  +downstreamnt
atgcctcttttcaggcgcggatcgcagcccgcacaccgcagaacacgtccgctgacagcc
gtcctggccttgacgctgacggcgaccgtgctgggcgcacccgctcctcccgctgtcgcg
gccgtaccggcggcggtcaccaccccgttcaaggcgggcggtgagggctaccgctgcttc
cgcatccccgcgctcgtcaccacgccctcgggcgccctgctggcgttcgcggaggggcgg
gtggccacctgcagcgacatcgggcacaacgacatcgtgatgcggaagtccacggacggc
ggccggagttggggcccgctgaaggtggtcgtgggcggcgccgacgaggacgcgcacggg
aacccggcaccggtcgtggacgcggcgaccgggcgggtgtcgctgctgtacgcgaccggc
ccctggagcggtacgccgggcgagccggtccgtggtccccggagcctgcgtgtggtgcac
agcgtggacgacggcgcgggctgggcggagggcgccccgctcccccacctgaagccggcg
ggacgggcctggatctcgacgggccccggccacggcatccagctcgcccggggcccgcac
cggggcaggctggtcgtcccgggcgactacacgaccacgggcggccgggcgggcggccag
ctgtacgtcagcgacgacggcggactgacctggtccctgggcgcccaggcggaggtcgac
cgggccaccgcccccgccttcccggccgagctgtccgtcgcggagacgaccggcggaggc
gtgtacgtcaacgcccgcagctccgcccggtgcggcaccgagaaccaccggatggccacc
accagcacggacggcggggccgccttcgacgccccgttctcccccgtgcccggcctcgac
accccgcccgtctccggctcgctgctgcgcctgcacgcgaaggagctgggcgcggtgcgg
gaccggctcctcttctccgccccctcccggctcggcccccacaccctggaggaccgccgg
gagctggcgatccgctcctcgtacgacgaggggcgcacctggcagacggcgggcacggtc
gtgacgccgggccgctccggctactcggatctggcccagctcccctcgggcgcgatcggg
gtcctctacgagagcgcggggaacatcccgcacagcgacctcgtcttcacctcgttcacc
gaggcccaactggacgcttcgcaccgcgaactgcgcctcccccgcacctcggacaccggc
cccaacgggtacggcaaccacgccctggtccacggcggcgcccagctcggcagccgcggt
tcgggcagggccatgaccttcgacggccaggacgactacctgcgcctggtctcctgctcg
gactcgctgcgcctgggcgcgggcgacttcaccctcacggcctggttccgccacaccgcc
acgacgggcgccctgccgatcgtctgggggtacgggatgggctcgggcgtccgccagttc
tggctgcgggccgagccgggccggggcgccgtccgggcggcgatcgacacgggcacggcg
tacgcggaggtgcggaccacgtcctcgtacaacgacggccagtggcaccacgcggtcctc
aggcgccaggcgggccggctggccctctccgtggacggcggccaggagttcaccgccgcg
gccccggcgggcgacatcaccccgcccgccgagttctccgtccacatcggcgcccgcccc
gacttcccgaaccagccggccggagtcaccgaactcttccgcggcggcctggacgacatc
cgcctcttcggccgcgccctgaccgcacaggaggcgtcccgggtgaagggcggggcgctg
gacgtggcgaacgaggaggagcgggtgcggttggggttctccggcatctggtag

DBGET integrated database retrieval system