KEGG   Streptomyces sp. CFMR 7: ABE83_13205Help
Entry
ABE83_13205       CDS       T04074                                 

Definition
(GenBank) membrane protein
  KO
K07058  membrane protein
Organism
scz  Streptomyces sp. CFMR 7
Brite
KEGG Orthology (KO) [BR:scz00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99996 General function prediction only
    ABE83_13205
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Virul_fac_BrkB Serine_rich TetR_C_16
Motif
Other DBs
NCBI-ProteinID: ALC27946
UniProt: A0A0M4DKX5
LinkDB All DBs
Position
complement(3267107..3268069)
Genome map
AA seq 320 aa AA seqDB search
MDWLKKLPVVGPLVSRLMETHAWRSYERLEKVHWARLAAAITFISFLALFPLIAVGAAIA
AALLSDQQLDTIKEKLAEQVPGISDQLGIDGLVANAGTVGLVAGALLLFTGVGWIGSMRE
CLRAVWELDDVQEANPVVAKLKDAVLLVGLGGAGLATLAVSTVGSTAVGWTAERLGIPEG
GAGGVLLRVAALLVAALGGFLLMLYLLSLLPGVEPPRRRLVVAAVIGAVGFELLKLLLGS
YMKEVAGKSMYGAFGVPIALLLWINFTAKLLLFCAAWTATGSKEEELETAGEPERAPEDG
PGNAEAAGPVQGAGGSTRTA
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
atggactggctcaagaaactccccgtcgtcgggccgctcgtctcccggctgatggagacg
cacgcctggcgctcctacgagcggctggagaaggtccactgggccaggctcgccgccgcg
atcaccttcatcagcttcctggcgctcttcccgctgatcgcggtcggcgcggccatcgcc
gccgcgctgctgagcgaccagcagttggacaccatcaaggagaagctggccgagcaggtg
ccgggcatctccgaccagctcggcatcgacggcctggtggccaacgcgggcacggtcggt
ctggtggccggtgcgctgctgctcttcaccggcgtcggctggatcggctcgatgcgggag
tgcctgcgcgcggtctgggagctggacgacgtgcaggaggccaacccggtcgtcgccaag
ctcaaggacgccgtgctcctggtcggcctgggcggcgccggactcgccaccctcgcggtc
tccacggtcggctccacggccgtcgggtggaccgccgagcggctcggcatccccgagggc
ggggcgggcggggtcctgctccgggtggccgccctgctggtggcggccctgggcggcttc
ctgctgatgctctatctgctctcgctgctgcccggcgtcgagccgccccggcgcaggctg
gtggtcgcggccgtgatcggcgcggtcggcttcgaactgctcaagctgctgctcggcagc
tatatgaaggaggtcgcgggcaagagcatgtacggggcgttcggcgtgccgatcgcgctg
ctgctctggatcaacttcaccgcgaaactgctgctgttctgcgccgcctggaccgcgacc
ggctccaaggaggaggagctggagacggccggggagccggagcgggcgccggaggacggg
ccggggaacgcggaagccgccgggcccgtgcagggcgccggcggctccacccgtaccgcc
tga

DBGET integrated database retrieval system