KEGG   Streptomyces sp. CFMR 7: ABE83_22260Help
Entry
ABE83_22260       CDS       T04074                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
scz  Streptomyces sp. CFMR 7
Pathway
scz00620  Pyruvate metabolism
scz00680  Methane metabolism
scz01100  Metabolic pathways
scz01120  Microbial metabolism in diverse environments
scz01200  Carbon metabolism
Module
scz_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:scz00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    ABE83_22260
  Energy metabolism
   00680 Methane metabolism
    ABE83_22260
Enzymes [BR:scz01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     ABE83_22260
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2
Motif
Other DBs
NCBI-ProteinID: ALC29481
UniProt: A0A0M5J4T8
LinkDB All DBs
Position
5295203..5297935
Genome map
AA seq 910 aa AA seqDB search
MSSADQTPAAATTELRADIRRLGDLLGETLVRQEGQELLDLVERVRALTRTDGEAAAELL
GDTALETAAQLVRAFSTYFHLANVTEQVHRAREMRERRSAEGGLLARTADRLKDADPEHL
RETVKNLNVRPVFTAHPTEAARRSVLNKLRRIAELLETPVIEADRRRHDLRLAENIDLIW
QTDELRVVRPEPADEARNAIYYLDELHANAVGDVLEDLTAELERVGVELPAGTRPLTFGT
WIGGDRDGNPNVTPAVTWDVLILQHEHGITDALELIDYLRGLLSNSIRYTGATDELLTSL
QADLERLPEISPRYKRLNAEEPYRLKATCIRQKLVNTRERLAQGTPHRPGCDYLGTSELL
ADLALIQTSLREHRGGLFADGRMDRTIRTLAAFGLQLATMDVREHADAHHHALGQLFDRL
GEESWRYADMPRDYRQKLLAKELRSRRPLAPTPAPLDAAGEKTLGVFHTIKEAFERFGPE
VIESYIISMCQGADDVFAATVLAREAGLIDLHAGWAEIGIVPLLETTDELKAADVILDAM
LADPSYRRLVSLRGDVQEVMLGYSDSSKFGGITTSQWEIHRAQRRLRDVAHRYGVRLRLF
HGRGGTVGRGGGPSHDAILAQPWGTLEGEIKVTEQGEVISDKYLIPALARENLELTVAAT
LQASALHTAPRQSDEALARWDAAMDTVSDAAHNAYRKLVEDPDLPAYFLASTPVDQLADL
HLGSRPSRRPGSGVSLDGLRAIPWVFGWTQSRQIVPGWYGVGSGLKALREAGLDTVLEEM
HEQWHFFRNFLSNVEMTLAKTDLRIARHYVDTLVPDELKHVFDAIEAEHALTVSEVLKVT
GSTELLGTSPALQQTFAIRDAYLDPISYLQVSLLARQRQAAERGEEPDPLLARALLLTVN
GVAAGLRNTG
NT seq 2733 nt NT seq  +upstreamnt  +downstreamnt
gtgagcagtgccgaccagacccccgccgccgccaccaccgagctgcgcgccgacatccgc
cgcctcggtgacctcctcggcgagaccctcgtacgccaggaaggccaggaactcctcgac
ctcgtcgagcgagtacgcgccctgacccgcaccgacggcgaagcggccgccgaactcctc
ggagacacggccctggagaccgccgcacagctcgtgcgcgccttctccacctacttccac
ctcgccaacgtcaccgagcaggtccaccgcgcccgcgagatgcgcgaacgccgctcggcc
gagggcggcctgctggcccgcaccgccgaccggctcaaggacgccgaccccgagcacctg
cgcgagacggtcaagaacctcaacgtgcggcccgtcttcaccgcccaccccaccgaggcc
gcccgccgctccgtcctcaacaagctccgccgcatcgcggaactgctggagaccccggtc
atcgaggccgaccgccgccgccacgacctccggctcgcggagaacatcgacctcatctgg
cagaccgacgaactccgcgtcgtccgcccggagcccgccgacgaggcccgcaacgccatc
tactacctcgacgagctccacgccaacgccgtcggggacgtcctcgaagacctcaccgcc
gaactggagcgcgtcggcgtcgaactccccgccggcacccgccccctcaccttcggcacc
tggatcggcggcgaccgcgacggcaaccccaacgtgacccccgccgtcacctgggacgtc
ctcatcctccagcacgagcacggcatcaccgacgccctcgaactcatcgactacctgcgc
ggcctgctctccaactccatccgctacacgggcgccaccgacgagctgctcacctccctc
caggccgacctggaacgcctccccgagatcagcccccgctacaagcggctgaacgccgag
gagccctaccgcctcaaggccacctgcatccgccagaagctcgtcaacacccgcgagcgc
ctcgcccagggcaccccccaccgccccggctgcgactacctcggcacctccgaactcctc
gcggacctggccctcatccagacctccctgcgcgagcaccgcggcggcctcttcgcggac
ggccgcatggaccgcaccatccgcaccctcgccgccttcggcctccagctcgccaccatg
gacgtacgcgaacacgccgacgcccaccaccacgcgctcggccagctcttcgaccgcctc
ggcgaggagtcctggcgctacgccgacatgccccgcgactaccggcagaagctgctcgcc
aaggagctgcgctcgcgccggccgctcgcccccacccccgccccgctcgacgcggccggc
gagaagaccctcggcgtcttccacaccatcaaggaagccttcgagcgcttcggccccgaa
gtcatcgagtcctacatcatctccatgtgccagggcgccgacgacgtcttcgccgccacc
gtcctcgcccgcgaggccggactcatcgacctccacgccggctgggccgagatcggcatc
gtcccgctcctggagaccaccgacgagctcaaggccgccgacgtcatcctcgacgcgatg
ctggccgacccctcctaccgccgcctcgtctccctccgcggcgacgtccaggaggtcatg
ctcggctacagcgactcctccaagttcgggggcatcaccaccagccagtgggagatccac
cgcgcccagcgccgcctccgcgacgtcgcccaccgctacggcgtacgcctgcgcctcttc
cacggccgcggcggcaccgtcggccgcggcggcggcccctcccacgacgcgatcctcgcc
cagccctggggcaccctggagggcgagatcaaggtcaccgagcagggcgaggtcatctcc
gacaagtacctcatccccgccctcgcccgcgagaacctggaactgaccgtcgcggccacc
ctccaggcctccgccctccacaccgcaccccgccagtccgacgaggccctcgcccgctgg
gacgcggccatggacaccgtctccgacgccgcccacaacgcctaccgcaagctcgtcgag
gaccccgacctcccggcctacttcctcgcctccaccccggtcgaccagctcgccgacctg
cacctgggctcacggccctcccgccgccccggctccggcgtctccctcgacggcctccgc
gccatcccgtgggtcttcggctggacccagtcccggcagatcgtccccggctggtacggc
gtcggctccggcctcaaggccctgcgcgaggccggactcgacaccgtcctcgaagagatg
cacgagcagtggcacttcttccggaacttcctctccaacgtggagatgacgctcgccaag
accgacctgcgcatcgcccggcactacgtcgacaccctcgtccccgacgagctgaagcac
gtcttcgacgccatcgaggccgaacacgccctgaccgtcagcgaagtcctcaaggtcacc
ggctccaccgaactcctcggcaccagccccgcgctccagcagaccttcgccatccgcgac
gcctacctggacccgatctcctacctccaggtctccctgctcgcccgccagcgtcaggcc
gccgaacgcggcgaagagcccgacccgctcctcgcccgcgccctgctgctcaccgtgaac
ggggtggcggcgggcctgcgcaacaccggctga

DBGET integrated database retrieval system