KEGG   Streptomyces sp. CFMR 7: ABE83_26285Help
Entry
ABE83_26285       CDS       T04074                                 

Definition
(GenBank) aldehyde dehydrogenase
Organism
scz  Streptomyces sp. CFMR 7
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: ALC30165
UniProt: A0A0M4DRB6
LinkDB All DBs
Position
6268482..6269960
Genome map
AA seq 492 aa AA seqDB search
MTERDDGTELVEHGQLFIGGEFTDPLGADVIEVVSPHTEEVIGRVPHASEGDVDRAVAAA
RRAFDEGPWPRMTLDERIAVVTRIKDAFAVRHEEFARLISAQNGTPYSASVMVQALAAMM
AWDAAITVARSFPYEERRDGVLGPLLVRREPVGVVAAVVPWNVPQFTAAAKLAPALLAGC
TAVLKVSPETPLDAYLLAEIVAEAGLPEGVLSILPADREVSEYLVGHRGVDKVSFTGSVA
AGRRVMEVASRNLTRVTLELGGKSAAVILPDADPEAAVAGIVPFAWMINGQACVAQTRIL
VPRSRYDELAEAFAAAAGALRVGDPLDPTTELGPLVARRQQQRSLDYIRLGQEEGAKILT
GGNVPASQERGWYVEPTLFGSVDNSMRIAREEIFGPVICLIPYGDEAEAVRIADDSPYGL
SGSVWTADTGRGIDIARRIRTGTYSVNTFSLDMLGPFGGYKNSGLGREFGPEGYGEFFEH
KMIHLPAGHREA
NT seq 1479 nt NT seq  +upstreamnt  +downstreamnt
atgacggaacgtgacgacggtacggagctggtggaacacggacagctgttcatcggcggg
gagttcaccgatccgctcggcgccgacgtcatcgaggtggtctccccgcacacggaggag
gtcatcggccgcgtgccgcacgcctccgaaggcgatgtggaccgggccgtcgccgccgcc
cgccgcgccttcgacgagggcccgtggccccggatgacgctggacgagcggatcgcggtg
gtcacccggatcaaggacgcgttcgccgtgcgccacgaggagttcgcgcgcctgatcagc
gcccagaacggcaccccgtacagcgcgagcgtgatggtgcaggcgctggccgcgatgatg
gcctgggacgcggcgatcacggtggcgcgctcgttcccgtacgaggagcggcgggacggg
gtcctcggcccgctgctggtccgccgggagccggtcggggtggtggccgcggtcgtcccg
tggaacgtcccccagttcacggccgccgccaaactggcccccgcactgctggcgggctgc
acggcggtcctgaaggtgtcgcccgaaaccccgctggacgcctacctgttggcggagatc
gtggcggaggcggggctgccggagggcgtcctctccatcctcccggccgaccgagaggtg
agcgagtacctggtgggccaccggggcgtcgacaaggtctccttcaccggctcggtcgcc
gccgggcgccgcgtgatggaggtcgcctcccgcaacctcacccgcgtcaccctggagctg
ggcggcaagtcggccgcggtgatcctgccggacgcggaccccgaggcggcggtcgcgggc
atcgtccccttcgcctggatgatcaacggccaggcgtgcgtggcccagacccgcatcctc
gtcccgcgctcccgctacgacgaactggcggaggcgttcgccgcggcggccggggccctc
cgcgtgggcgaccccctggaccccaccacggagctgggccccctggtcgcccgccgccag
cagcagcgctccctcgactacatccgcctgggccaggaggagggcgccaagatcctcacc
ggcggcaacgtacccgcctcccaggagcgcggctggtacgtcgagcccaccctcttcggc
tcggtcgacaactccatgcgcatcgcccgcgaggagatcttcggcccggtgatctgcctg
atcccgtacggggacgaggccgaggccgtccggatcgccgacgactccccgtacggcctc
agcggcagcgtctggaccgccgacaccggacgcggcatcgacatcgcccgccgcatccgc
accggcacgtacagcgtgaacaccttcagcctggacatgctcggcccgttcggcggctac
aagaactccggtctgggccgcgagttcggccccgaggggtacggcgagttcttcgagcac
aagatgatccacctccccgccggccaccgggaggcctga

DBGET integrated database retrieval system