KEGG   Streptococcus dysgalactiae subsp. equisimilis RE378: GGS_0522Help
Entry
GGS_0522          CDS       T02269                                 

Gene name
amyS
Definition
(GenBank) cytoplasmic alpha-amylase
  KO
K01176  alpha-amylase [EC:3.2.1.1]
Organism
sda  Streptococcus dysgalactiae subsp. equisimilis RE378
Pathway
sda00500  Starch and sucrose metabolism
sda01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sda00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    GGS_0522 (amyS)
Enzymes [BR:sda01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     GGS_0522 (amyS)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alpha-amylase DUF1939 Glyco_hydro_70
Motif
Other DBs
NCBI-ProteinID: BAM60678
UniProt: M4YX20
LinkDB All DBs
Position
531750..533213
Genome map
AA seq 487 aa AA seqDB search
MTNQLIMQAFEWYLPADGNHWKTVKASIPQLQHLGVTELWLPPAFKGTGINDVGYGVYDL
FDLGEFDQNGTVITKYGSKQEYLDLITALKEAAIKPIADIVLNHKANGDHKERFFVIKMN
SENRQEALTEPYEIEGWTGFDFPGRNGCYNDFKWHWYHFTGLDYDAKNNETGIYMITGDN
KGWANNDLIDDEHGNFDYLMYNDLDFKHPEVIQNLQDWAKWFIETTGIEGFRLDAVKHID
SYFIQTFVNDIRTQIKPDLEVFGEYWKSDQDSMEDYLEATNEQFALVDVGLHMSFFNASH
QGKDFDLTHIFEGSLVASRPDLAITFVENHDTQRGQALESTVEDWFKPLAYGLILLRQEG
KPCLFYGDYYGISGDFAQASFKEVLDKLTLLRKEAVYGEQVDYFDHANCIAWTCLGDEEH
PHPLAVILSNGDEGWKHVEIGQDFVGQTFVDYLGHCSEKVVVAEDGWLDIKVETGSISAW
VPEERSF
NT seq 1464 nt NT seq  +upstreamnt  +downstreamnt
atgacaaatcaactaatcatgcaggcttttgagtggtatcttcctgcagatggtaaccac
tggaaaacagtgaaagcaagtattccacaattacagcatttaggagtgactgagctctgg
cttcctcctgcttttaaaggaactggtattaatgatgtgggatatggtgtttatgattta
tttgacctaggggaatttgatcaaaatggcacagtcattaccaaatacggtagtaaacaa
gaatatctcgaccttattacagctttgaaagaagctgccatcaaaccaatcgcagatatt
gttcttaaccataaagccaatggagatcataaggaacgtttttttgtcatcaaaatgaat
tctgaaaatcgccaggaagctctgacagaaccttatgagattgaaggctggactggtttt
gactttcctggtcgaaatggttgctataatgattttaaatggcattggtatcatttcaca
gggcttgattatgatgccaagaacaatgaaactggcatttacatgattacaggtgacaat
aagggctgggccaacaatgacttgattgatgacgaacatggtaattttgattacctcatg
tacaatgatttggacttcaaacacccagaggttattcaaaacttgcaggattgggctaag
tggtttattgagacaacaggaatcgaaggttttcgtctagatgccgtcaaacacattgat
tcttattttatccaaacctttgtcaatgatattcgcactcaaatcaaaccagatttagaa
gtttttggtgagtattggaagtcagaccaagactccatggaagactacttggaagccacc
aatgaacagtttgctttagtagatgtcggtcttcacatgtctttctttaacgccagtcat
caaggaaaggattttgatttaacacatatctttgaaggaagtttagtggctagcaggcct
gacttggctattacttttgttgaaaatcatgacacgcaacgtggtcaagctttggagtcc
acagtggaagattggtttaaacctctggcctacggcttaattctcttgcgccaagaaggc
aaaccttgtctgttctatggcgattattatggtatttccggagactttgctcaagctagt
tttaaagaagtgcttgacaagttgacgctgttgcgtaaagaggctgtttacggggaacaa
gtcgattattttgatcacgctaattgcattgcctggacttgtttaggcgatgaagaacat
ccccatccgctggcagttatcctatcaaatggtgatgaaggttggaagcatgtggaaatc
ggtcaagactttgtcgggcagacctttgtcgattacttaggccattgttcagaaaaggta
gtggtggctgaagatggttggcttgatattaaggtggagacaggctctatttcagcctgg
gtacctgaagaaagaagcttttaa

DBGET integrated database retrieval system