KEGG   Streptococcus dysgalactiae subsp. equisimilis RE378: GGS_0875Help
Entry
GGS_0875          CDS       T02269                                 

Gene name
tdk
Definition
(GenBank) truncated thymidine kinase Tdk
  KO
K00857  thymidine kinase [EC:2.7.1.21]
Organism
sda  Streptococcus dysgalactiae subsp. equisimilis RE378
Pathway
sda00240  Pyrimidine metabolism
sda01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sda00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    GGS_0875 (tdk)
Enzymes [BR:sda01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     GGS_0875 (tdk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TK KdpD AAA_22 AAA_30 DUF4371
Motif
Other DBs
NCBI-ProteinID: BAM61024
UniProt: M4YWM1
LinkDB All DBs
Position
918618..919220
Genome map
AA seq 200 aa AA seqDB search
MAQLYYKYGTMNSGKTIEILKVAHNYEEQGKPVVIMTSALDTRDGFGVVSSRIGMRREAV
PISSDMDVFTFIDQLEEKPYCVLIDESQFLSKQNVYDLARVVDKLNVPVMAFGLKNDFQN
ELFEGSKYLLLLADKIDEIKTICQYCSKKATMVLRTENGKPVYEGAQIQIGGNETYIPVC
RKHYFHPPVSTEQSVMTEKN
NT seq 603 nt NT seq  +upstreamnt  +downstreamnt
ttggctcaactctattataaatatgggacaatgaattctggtaaaaccattgaaatttta
aaagtagcacataattatgaagaacaaggcaaacctgttgtcattatgacaagtgctctt
gatacgcgtgatggttttggcgtcgtttcaagtcgtatcggcatgcgacgagaagcagtt
cctatttctagtgatatggatgtttttacctttattgaccaattggaggaaaaaccttat
tgtgtcttgattgacgaaagccaatttttaagcaagcaaaatgtttatgatttggcgcgt
gtggtggataagttaaatgttcctgtcatggcttttgggttgaaaaatgattttcaaaat
gaactgtttgagggatcaaaataccttttgcttctggccgataagattgacgaaatcaaa
acaatctgtcaatattgcagcaagaaagccacgatggttttacggactgaaaatggaaaa
ccggtgtatgagggtgctcagatacaaatcggagggaatgaaacctatattccagtttgc
cgtaagcattactttcacccacccgttagcaccgaacagtcagtaatgactgagaaaaac
taa

DBGET integrated database retrieval system