KEGG   Streptococcus dysgalactiae subsp. equisimilis RE378: GGS_1886Help
Entry
GGS_1886          CDS       T02269                                 

Gene name
ahpF
Definition
(GenBank) NADH dehydrogenase
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
sda  Streptococcus dysgalactiae subsp. equisimilis RE378
Brite
KEGG Orthology (KO) [BR:sda00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    GGS_1886 (ahpF)
Enzymes [BR:sda01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     GGS_1886 (ahpF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox FAD_binding_2 FAD_oxidored Thioredoxin_3 GIDA Thi4 HI0933_like Glutaredoxin FAD_binding_3 DAO AlaDh_PNT_C Lycopene_cycl Thioredoxin_4 NAD_binding_8 LPD7 FMO-like K_oxygenase
Motif
Other DBs
NCBI-ProteinID: BAM62001
UniProt: M4ZGQ5
LinkDB All DBs
Position
2044275..2045807
Genome map
AA seq 510 aa AA seqDB search
MALSPDIKEQLAQYLTLLESDLVLQAYLGDDEQSQKVKDFVEEIAAMSDRISVEETVLDR
KPSFKVAKKGQDSGVAFAGLPLGHEFTSFILALLQVSGRAPKVDQDVIDRIKAIDRPLHF
ETYVSLTCHNCPDVVQALNIMSVLNDKISHTMVEGGMFQDEVKAKGIMSVPTVFLDGEEF
TSGRATIEQLLEQVAGPLSEEAFADKGVYDVLVVGGGPAGNSAAIYAARKGLKTGLLAET
FGGQVMETVGIENMIGTLYTEGPKLMAEVEAHTKSYDVDIIKAQLATSIEKKENIEVTLA
NGAVLQAKTAILALGAKWRNINVPGEDEFRNKGVTYCPHCDGPLFEGKDVAVIGGGNSGL
EAALDLAGLAKHVYVLEFLPELKADKVLQDRAADTANMTIIKNVATKDIVGDDHVTGLNY
TERDSGEDKHIDLEGVFVQIGLVPNTAWLKDSGVNLTDRGEIIVDKHGSTNIPGIFAAGD
CTDSAYKQIIISMGSGATAAIGAFDYLIRQ
NT seq 1533 nt NT seq  +upstreamnt  +downstreamnt
atggcattaagtcctgatattaaagaacaacttgcccaatacctcaccttgttagaatct
gacctggttttgcaagcttatcttggtgatgacgaacagtctcaaaaggttaaagacttc
gtggaagaaattgctgcgatgtctgatcgtatttcggttgaagaaactgtcttagaccgt
aaaccaagctttaaagttgcgaaaaaaggacaagatagtggggttgcctttgctggtcta
cctttaggccacgaatttacgtctttcatccttgccctcttgcaagtatctggacgtgct
ccaaaagtagatcaagatgttattgaccgcatcaaggctattgatcgcccactgcatttt
gaaacctacgtcagcttaacctgccataactgtccagacgttgttcaagctctcaacatt
atgtctgttttgaatgacaagatttcacatactatggtggaaggtggcatgttccaagat
gaagtgaaagcaaaaggcattatgtctgtaccaactgtcttcttagatggtgaagaattc
acttcaggccgtgctactatcgaacaactcttagaacaagtcgctggtcccctttcagaa
gaagcctttgcggataaaggggtgtatgatgtccttgttgttggtggtggacctgcgggc
aatagcgctgctatctatgcagcccgtaaaggattgaaaacaggtttattggctgagacc
tttggtggtcaggtcatggaaactgtcggcatcgaaaatatgattggtaccctttacact
gaaggaccaaaattaatggccgaagtagaggcccataccaagtcttacgatgtggacatt
atcaaagcacaactagctacttctatcgagaaaaaagaaaacatcgaggttactctagct
aatggtgcggttttacaagccaaaactgctattttagctcttggtgccaaatggcgtaac
atcaatgttcctggagaagatgaattccgtaataaaggggtgacttactgccctcactgt
gatggtcctctctttgaaggcaaggacgttgctgttatcggtggtggaaactctggatta
gaagctgcccttgatttggctggtcttgctaaacacgtttacgtgttagaattcttgcct
gagctcaaagctgacaaagtgcttcaagaccgcgcagctgatactgctaacatgactatt
atcaaaaatgttgctactaaagacattgttggtgacgatcatgttactggtctcaactac
actgaacgtgatagcggtgaagacaaacacattgaccttgaaggggtctttgtccaaatt
ggtcttgttccaaatacagcttggctcaaggatagcggtgtgaacctaaccgaccgcggt
gaaattatcgtggataaacatgggtcaaccaatattcctggtatctttgctgctggggac
tgtactgattcagcttataaacaaatcattatttccatggggtctggtgctactgctgcc
atcggtgcctttgactacttgattcgtcaataa

DBGET integrated database retrieval system