KEGG   Streptococcus dysgalactiae subsp. equisimilis AC-2713: SDSE_0576Help
Entry
SDSE_0576         CDS       T02333                                 

Gene name
amyS
Definition
(GenBank) K01176 alpha-amylase
  KO
K01176  alpha-amylase [EC:3.2.1.1]
Organism
sdc  Streptococcus dysgalactiae subsp. equisimilis AC-2713
Pathway
sdc00500  Starch and sucrose metabolism
sdc01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sdc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    SDSE_0576 (amyS)
Enzymes [BR:sdc01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     SDSE_0576 (amyS)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alpha-amylase DUF1939 Glyco_hydro_70
Motif
Other DBs
NCBI-ProteinID: CCI62074
UniProt: K4Q8L5
LinkDB All DBs
Position
517658..519121
Genome map
AA seq 487 aa AA seqDB search
MTNQLIMQAFEWYLPADGNHWKTVKASIPQLQHLGVTELWLPPAFKGTGINDVGYGVYDL
FDLGEFDQNGTVITKYGSKQEYLDLITALKEAAIKPIADIVLNHKANGDHKERFFVIKMN
PENRQEALTEPYEIEGWTGFDFPGRNGCYNDFKWHWYHFTGLDYDAKNNETGIYMITGDN
KGWANNDLIDDEHGNFDYLMYNDLDFKHPEVIQNLQDWAKWFIETTGIEGFRLDAVKHID
SYFIQTFVNDIRTQIKPDLEVFGEYWKSDQDSMEDYLEATNEQFALVDVGLHMSFFNASH
QAKDFDLTHIFEGSLVASRPDLAITFVENHDTQRGQALESTVEDWFKPLAYGLILLRQEG
KPCLFYGDYYGISGDFAQASFKEVLDKLTLLRKEAVYGEQVDYFDHANCIAWTCLGDEEH
PHPLAVILSNGDEGWKHVEIGQDFVGQTFVDYLGHCSEKVVVAEDGWLDIKVETGSISAW
VPEERSF
NT seq 1464 nt NT seq  +upstreamnt  +downstreamnt
atgacaaatcaactaatcatgcaggcttttgagtggtatcttcctgcagatggtaaccac
tggaaaacagtgaaagcaagtattccacaattacagcatttaggagtgactgagctctgg
cttcctcctgcttttaaaggaactggtattaatgatgtgggatatggtgtttatgattta
tttgacctaggggaatttgatcaaaatggcacagtcattaccaaatacggtagtaaacaa
gaatatctcgaccttattacagctttgaaagaagctgccatcaaaccaatcgcagatatt
gttcttaaccataaagccaatggagatcataaggaacgtttttttgtcatcaaaatgaat
cctgaaaatcgccaggaagctctgacagaaccttatgagattgaaggctggactggtttt
gactttcctggtcgaaatggttgctataatgattttaaatggcattggtatcatttcaca
gggcttgattatgatgccaagaacaatgaaactggcatttacatgattacaggtgacaat
aagggctgggccaacaatgacttgattgatgacgaacatggtaattttgattacctcatg
tacaatgatttggacttcaaacacccagaggttattcaaaacttgcaggattgggctaag
tggtttattgagacaacaggaatcgaaggttttcgtctagatgccgtcaaacacattgat
tcttattttatccaaacctttgtcaatgatattcgcactcaaatcaaaccagatttagaa
gtttttggtgagtattggaagtcagaccaagactccatggaagactacttggaagccacc
aatgaacagtttgctttagtagatgtcggtcttcacatgtctttctttaacgccagtcat
caagcaaaggattttgatttaacacatatctttgaaggaagtttagtggctagcaggcct
gacttggctattacttttgttgaaaatcatgacacgcaacgtggtcaagctttggagtcc
acagtggaagattggtttaaacctctggcctacggcttaattctcttgcgccaagaaggc
aaaccttgtctgttctatggcgattattatggtatttccggagactttgctcaagctagt
tttaaagaagtacttgacaagttgacgctgttgcgtaaagaggctgtttacggggaacaa
gtcgattattttgatcacgctaattgcattgcttggacttgtttaggcgatgaagaacat
ccccatccgctggcagttatcctatcaaatggtgatgaaggttggaagcatgtggaaatc
ggtcaagactttgtcgggcagacctttgtcgattacttaggccattgttcagaaaaggta
gtggtggctgaagatggttggcttgatattaaggtggagacaggctctatttcagcctgg
gtacctgaagaaagaagcttttaa

DBGET integrated database retrieval system