KEGG   Streptococcus dysgalactiae subsp. equisimilis AC-2713: SDSE_1217Help
Entry
SDSE_1217         CDS       T02333                                 

Definition
(GenBank) K01928 UDP-N-acetylmuramoylalanyl-D-glutamate--2,6-diaminopimelateligase
  KO
K23393  lipid II isoglutaminyl synthase (glutamine-hydrolysing) [EC:6.3.5.13]
Organism
sdc  Streptococcus dysgalactiae subsp. equisimilis AC-2713
Pathway
sdc00550  Peptidoglycan biosynthesis
sdc01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sdc00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    SDSE_1217
Enzymes [BR:sdc01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.13  lipid II isoglutaminyl synthase (glutamine-hydrolysing)
     SDSE_1217
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF1727 Mur_ligase_M
Motif
Other DBs
NCBI-ProteinID: CCI62711
UniProt: K4Q9Q2
LinkDB All DBs
Position
1146193..1147536
Genome map
AA seq 447 aa AA seqDB search
MKMKTLLGLSAGKTAQLILKKLGRGSTYPGRLALAFDKDILDSLSKDYEIVVITGTNGKT
LTTALTVGILKEAFGDVLTNPSGANMITGITAAFLSAKKGKSGKHIAVLEIDEASLPKIT
NYLKPSLFVYTNIFRDQMDRYGEIYTTYQMIVDGARNAPKATILANGDSPIFSSKDIVNP
VQYYGFDTAKHAPQLAHYNTEGILCPKCEHILQYRLNTYANLGDFICLNCQFQRPTLDYQ
LTELTAITHQSSEFVIDGQNYKINVGGLYNIYNALAAVSVAEFFGVSSEKIKAGFNKSKA
VFGRQETFTIGDKSCTLILIKNPVGASQALEMIQLADYPLSLSVLLNANYADGIDTSWIW
DANFELITQMPITEINAGGVRHSEIARRLRVTGFDDTKIKQAEKLEQIIETIEKQEAKHA
YILATYTAMLEFRSLLADRHVVEKEMI
NT seq 1344 nt NT seq  +upstreamnt  +downstreamnt
atgaaaatgaagacattactcggtctcagtgccggcaaaacagctcaattgatattaaag
aaactagggcgcggttctacttatcccggccgtttagcactagccttcgataaagatatt
ttagatagcctctcaaaagattatgagattgttgtcatcacaggtaccaatgggaaaaca
ttaacaacagctttaaccgtaggcatcttgaaagaagcatttggcgacgtacttaccaac
ccgagcggtgctaatatgattacggggattaccgcggcttttttatcagctaaaaaagga
aaatctggtaaacacattgctgtcttggaaattgatgaagcaagtcttccaaagattact
aattacctcaaaccaagtctctttgtctacaccaatatttttagagatcaaatggaccgc
tatggggagatttatactacttatcagatgattgtagatggtgctcgaaatgctccaaaa
gcaactattctagccaatggagatagtcctattttctcttctaaggacatagttaatcca
gttcagtattatggttttgatactgctaagcatgctccgcagctagctcattacaacaca
gaagggattttatgtccaaaatgcgaacatattcttcagtatcgtctcaatacttatgcg
aatctaggagactttatttgcttaaactgtcagttccaaagaccaacgttagattatcaa
ttaactgagctcaccgctattactcaccaaagttctgaatttgttattgatggacaaaac
tacaagataaatgttggtggtctttataatatttacaatgcgcttgctgccgtctctgtt
gctgaatttttcggtgtttcttccgagaaaatcaaggcgggctttaacaaaagtaaggcg
gtttttggaagacaagaaacttttactattggtgataaatcatgcacccttatccttatc
aagaatcctgttggagccagtcaagcgcttgaaatgattcagctagctgattacccactt
agcttatctgtgcttttaaatgctaattatgctgacggcattgataccagctggatttgg
gatgctaattttgaactcattacccaaatgcccattacagaaattaatgctggcggcgtc
cgtcactctgaaattgccagaagacttagagtcacaggatttgacgacactaaaataaag
caagctgaaaagctcgagcaaatcatagaaactattgaaaaacaagaagctaagcatgcc
tatattttagcaacctatacagcaatgttagaattccgtagcttacttgctgaccgccat
gtcgttgaaaaggagatgatctaa

DBGET integrated database retrieval system